KEGG   Mycobacterium dioxanotrophicus: BTO20_34400Help
Entry
BTO20_34400       CDS       T05102                                 

Definition
(GenBank) fumarate reductase/succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mdx  Mycobacterium dioxanotrophicus
Pathway
mdx00020  Citrate cycle (TCA cycle)
mdx00190  Oxidative phosphorylation
mdx00650  Butanoate metabolism
mdx01100  Metabolic pathways
mdx01110  Biosynthesis of secondary metabolites
mdx01120  Microbial metabolism in diverse environments
mdx01130  Biosynthesis of antibiotics
mdx01200  Carbon metabolism
Module
mdx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mdx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mdx_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mdx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BTO20_34400
   00650 Butanoate metabolism
    BTO20_34400
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BTO20_34400
Enzymes [BR:mdx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BTO20_34400
    1.3.5.4  fumarate reductase (quinol)
     BTO20_34400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 HI0933_like DAO GIDA FAD_oxidored Lycopene_cycl Pyr_redox_3 FAD_binding_3 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ART72971
UniProt: A0A1Y0CCI9
LinkDB All DBs
Position
7126082..7127992
Genome map
AA seq 636 aa AA seqDB search
MAELERHQYDVVVIGAGGAGLRAVIEARERGLRVAVVTKSLFGKAHTVMAEGGCAAAMRN
VNTKDSWQVHFGDTMRGGKFLNNWRMAELHAQEAPDRVWELESYGALFDRTKDGRISQRN
FGGHTYPRLAHVGDRTGLEIIRTLQQKIVSLQQEDKAELGDYEARIRVFHETAITDLIKD
GDRIAGAFGYYRETGNFVLFEAPAIVLATGGIGKSFKVSSNSWEYTGDGHALALRAGSGL
INMEFIQFHPTGMVWPLSVKGILVTEGVRGDGGVLKNSEGKRFMFDYIPAVFKGQYAETE
EEADQWLKDNDSARRTPDLLPRDEVARAINSEVKAGRGSPHGGVYLDIASRMPTEEIKRR
LPSMYHQFMELAEVDITKDEMEVGPTCHYVMGGIEVDPDTGGAVTPGLFAAGECSGGMHG
SNRLGGNSLSDLLVFGRRAGLGAADYVQALAERPAVSEAAIVEATQLALDPFEKHANPEN
PYTLHAELQQCMNDLVGIIRKADEIEEALAKLAELKTRVHSVTVEGGRAFNPGWHLAIDM
RNMLLVSECVAKAALARTESRGGHTRDDYPEMDANWRNTLLVCRAVGDDDQVVPDVTVTP
ESQLPMRADLLATFELSELEKYYTEQELAEHPDRKG
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atggctgaactggaacggcaccaatacgacgttgtcgtcatcggtgccggcggtgcaggg
ctgcgtgcggtgatcgaggcgcgtgagcggggtctgcgggtggcggtggtgaccaaatcg
ctgttcggcaaagcacatacagtgatggccgagggcgggtgcgccgcggcgatgcgcaac
gtcaacaccaaggactcgtggcaggtgcacttcggtgacaccatgcgcggcggcaagttc
ctcaacaactggcggatggccgaactgcacgcgcaagaggccccggaccgcgtgtgggag
ttggagtcctacggcgcgttgttcgaccgcaccaaggacggccggatcagccagcgcaac
ttcggcgggcacacctacccgcggctggcccacgtcggcgaccgtaccggcctggagatc
atccgcaccctgcagcagaagatcgtctcgctgcagcaggaggacaaggccgaactcggt
gactatgaggcccgcatcagggttttccacgaaaccgccatcaccgacctgatcaaagac
ggtgaccgcatcgcgggcgcgttcgggtactaccgcgagaccggcaatttcgtgctgttc
gaggcccccgcgatcgtgctggccaccggaggcatcggcaagtccttcaaggtgtcgtcg
aactcgtgggagtacaccggagacggccatgcgttggctctgcgcgccggatccggtctg
atcaacatggagttcatccagttccacccgaccggcatggtgtggccgctgtcggtgaag
ggcatcctggtcaccgaaggtgtccgcggtgacggcggagtgctgaagaactccgaaggc
aagcggttcatgttcgactacatccccgcggtgttcaaggggcagtacgccgaaaccgaa
gaagaagccgaccagtggctcaaggacaacgattccgcgcgccgcacccctgacctgctg
ccccgcgacgaggtggcccgcgccatcaactccgaggtcaaggcgggacgcggctcgcca
cacggcggcgtgtacctcgacatcgcttcgcggatgccgaccgaggagatcaagcggcgg
ctgccgtcgatgtaccaccagttcatggagctcgccgaggtcgacatcaccaaggacgag
atggaggtcgggccgacctgtcactacgtgatgggcggtatcgaagtcgaccccgacacc
ggcggggccgtcacgcccgggctgttcgccgcgggtgagtgttcgggcgggatgcacggc
tcgaaccggctgggcggcaactcgttgagtgaccttctggtgttcggccgccgcgccgga
ctcggggccgccgactacgtgcaggcccttgccgagcggccggccgtgtcggaggccgcc
atcgtcgaggccacccagctggcactggacccgttcgaaaagcatgcgaatccggagaat
ccgtacaccctgcacgccgagctgcaacagtgcatgaacgatctggtcggcatcatccgc
aaggccgacgagatcgaggaggccctggccaagctcgccgaactcaagacccgcgtgcac
agcgtcaccgtcgagggcggccgcgccttcaacccgggctggcacctggccatcgacatg
cgcaacatgctgctggtcagcgagtgcgtcgccaaggccgcgctggcccgcaccgagagc
cggggcgggcacacccgcgacgactacccggagatggacgccaactggcgcaacacgctg
ctggtgtgccgcgcagttggcgacgacgaccaggtagtgccggacgtgacggtgacgccg
gagtcgcagctacccatgcgggccgacctgctggccacgttcgagctgtccgaattggag
aagtactacaccgagcaagaactggccgagcaccccgatcggaagggctga

DBGET integrated database retrieval system