KEGG   Mycobacterium dioxanotrophicus: BTO20_34405Help
Entry
BTO20_34405       CDS       T05102                                 

Definition
(GenBank) succinate dehydrogenase/fumarate reductase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mdx  Mycobacterium dioxanotrophicus
Pathway
mdx00020  Citrate cycle (TCA cycle)
mdx00190  Oxidative phosphorylation
mdx00650  Butanoate metabolism
mdx01100  Metabolic pathways
mdx01110  Biosynthesis of secondary metabolites
mdx01120  Microbial metabolism in diverse environments
mdx01130  Biosynthesis of antibiotics
mdx01200  Carbon metabolism
Module
mdx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mdx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mdx_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mdx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BTO20_34405
   00650 Butanoate metabolism
    BTO20_34405
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BTO20_34405
Enzymes [BR:mdx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BTO20_34405
    1.3.5.4  fumarate reductase (quinol)
     BTO20_34405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer2 Fer4_17 Fer4_18 Fer4_9 Fer4_16
Motif
Other DBs
NCBI-ProteinID: ART72972
UniProt: A0A1Y0CCX5
LinkDB All DBs
Position
7127994..7128743
Genome map
AA seq 249 aa AA seqDB search
MAAYNANLRVWRGDDTGGDLQDYTVEVNDGEVVLDIIHRLQATQTPDLAVRWNCKAGKCG
SCSAEINGRPRLMCMTRMSTFDPAETVTVTPLRTFPVMRDLVTDVSFNYEKARQIPSFTP
PKDLQPGEYRMQQEDVNRSQEFRKCIECFLCQNVCHVVRDHEENKQNFAGPRFHMRIAEL
DMHPLDTVDRRDMAQDEFGLGYCNITKCCTEVCPENIKITDNALIPMKERVVDRKYDPIV
WLGNKLFRR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctacaacgcgaacctgcgggtctggcgtggagacgacactggcggtgacttg
caggactacaccgtcgaggtcaatgacggcgaggtggtgctcgacatcatccaccggctg
caggccacccagaccccggatctggccgtgcggtggaactgcaaggccggcaagtgcgga
tcctgctcggccgagatcaacggccgtccgcggctcatgtgcatgacccggatgtcgaca
ttcgacccggccgagaccgtcacggtgacgccgctgcgcaccttccccgtgatgcgtgac
ctggtcaccgatgtgtccttcaactacgagaaggcgcgccagatcccgtcgttcaccccg
ccgaaagacctgcagcccggtgagtaccggatgcagcaggaggacgtgaaccgcagccag
gaattccgcaagtgcatcgagtgcttcctgtgccagaacgtctgtcacgtggtgcgcgac
cacgaggagaacaagcagaacttcgcaggcccccggttccacatgcgcatcgccgagctg
gacatgcatccgcttgacaccgtggaccgccgcgacatggcccaggacgagttcggcctg
ggttattgcaacatcaccaagtgctgcaccgaggtctgccccgagaacatcaagatcacc
gacaacgcgctgatcccgatgaaggagcgcgtcgtggaccggaagtacgacccgatcgtg
tggctgggcaacaagctgttccgccgatga

DBGET integrated database retrieval system