KEGG   Mycobacterium dioxanotrophicus: BTO20_34820Help
Entry
BTO20_34820       CDS       T05102                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
mdx  Mycobacterium dioxanotrophicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Caleosin
Motif
Other DBs
NCBI-ProteinID: ART74113
UniProt: A0A1Y0CFP0
LinkDB All DBs
Position
7234761..7236245
Genome map
AA seq 494 aa AA seqDB search
MTQSSSATAFQTEWDKLFIGGQWVEPATAEVIEVHSPATGELVGKVPLATQGDVDAACAA
ARTAFDEGPWPTMKPADRAAILARAVKIMEERADELKFLLAAETGQPASIVDMMQYGAAM
SSFNYYAASAVDKFSWSEIRDGIYGQTLVTREPIGVVAAVAAWNVPFFLAANKLGPALLA
GCTVVLKPAAETPLSVFAMAQAFAEAGLPEGVLSVVPGGPDTGRALIANPEIDKFTFTGS
SAVGKEIGKVAAERLKPCTLELGGKSAAIILEDADLDSTLPMLIFSGLMNCGQACVGQTR
ILAPRSRYDEVVEKVSAGVAAMKVGLPDDPAAMIGPLISEKQRDRVEGYIHKGVEEGARI
VTGGGRPEGLDSGWFVQPTVFADVDNAMTIAQEEIFGPVLVVIPFDTEEDAVRIANDSVY
GLAGSVYTTDIPKAMEIASKIRTGTYGVNMYAFDPGAPFGGYKNSGIGRENGPEGIEAYC
QAKSVLLPFGYTPE
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacacagagctcatccgcgaccgcgtttcagaccgagtgggacaagctgttcatcggc
ggccagtgggtcgagccggccacggccgaggtgatcgaggtgcactcccccgccaccggt
gagctggtcggcaaggtgccgctggccacccagggcgacgtggacgccgcgtgcgccgct
gcccgcaccgcgttcgacgagggcccatggcccaccatgaagccggccgaccgggccgca
atcctcgcccgcgcggtcaagatcatggaagagcgcgccgacgaactgaagttcctgctg
gccgccgagaccggtcagcccgccagcatcgtcgacatgatgcagtacggcgcggcgatg
tcgtcgttcaactactacgccgcgtccgcggtcgacaagttcagctggagcgagatccgc
gacggtatctacggccagaccttggtgacccgcgagcccatcggtgtcgtcgccgcggtc
gcggcctggaacgtgccgttcttcctggccgccaacaagctcggcccggcgctgctggcc
ggctgcaccgtcgtgctcaagccggccgccgagacaccgctgtcggtgttcgcgatggcc
caggcgttcgccgaggccggactgcccgaaggcgtgctgtctgtcgtcccgggtggcccc
gacaccggccgcgccctgatcgccaatcccgagatcgacaagttcacgttcaccggctcc
agtgccgtcggcaaggagatcggcaaggtcgccgccgaacggctcaagccgtgcacgctg
gaactcggcggcaagtccgcggcgatcattctggaggacgccgacctggactccacgctg
ccgatgttgatcttctccggcctgatgaactgcggacaggcgtgcgtcgggcagacccgc
atcctggcaccgcgatcgcgttacgacgaggtcgtcgagaaggtgtccgcgggcgtggcg
gccatgaaggtcggcctgcccgacgacccggccgccatgatcggcccgctgatcagcgag
aagcaacgcgaccgggtcgagggctacatccacaagggcgtcgaggagggcgcccgcatc
gtcaccggcggcggccggcccgagggcctggattcgggctggttcgtgcagccgacggtg
ttcgccgacgtcgacaacgcgatgaccatcgctcaggaggagatcttcgggccggtgctg
gtggtgatcccgttcgacactgaggaggacgccgtccgcatcgccaacgactcggtctac
ggactggccggcagcgtctacacgaccgacatcccgaaggcgatggagatcgcgagcaag
atccgcaccggcacctacggcgtcaacatgtacgcgttcgacccgggcgcgccgttcggc
ggatacaagaattcgggtatcggtcgggagaacggacccgagggtatcgaggcctactgc
caggccaagagcgtgctgctgccgttcggttacacacccgaataa

DBGET integrated database retrieval system