KEGG   Methylorubrum extorquens AM1: Mex_1p1361Help
Entry
Mex_1p1361        CDS       T00921                                 

Gene name
atpA
Definition
(GenBank) ATP synthase F1 sector subunit alpha
  KO
K02111  F-type H+/Na+-transporting ATPase subunit alpha [EC:7.1.2.2 7.2.2.1]
Organism
mea  Methylorubrum extorquens AM1
Pathway
mea00190  Oxidative phosphorylation
mea01100  Metabolic pathways
Module
mea_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:mea00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Mex_1p1361 (atpA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:mea00194]
    Mex_1p1361 (atpA)
Enzymes [BR:mea01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     Mex_1p1361 (atpA)
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     Mex_1p1361 (atpA)
Photosynthesis proteins [BR:mea00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   Mex_1p1361 (atpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_C ATP-synt_ab_N HAS-barrel TniB
Motif
Other DBs
NCBI-ProteinID: ACS39223
UniProt: C5AYV7
LinkDB All DBs
Position
complement(1417678..1419207)
Genome map
AA seq 509 aa AA seqDB search
MDIRAAEISAILKEQIKNFGQEAEVTEVGQVLAVGDGIARVYGLDNVQAGEMVEFESGVR
GMALNLEQDNVGVVIFGSDREIKEGQTVKRTGSIVDVPVGKGLLGRVVDGLGNPIDGKGP
IQSTERRRVDVKAPGIIPRKSVHEPMSTGLKAIDALIPVGRGQRELIIGDRQTGKTAIAL
DTILNQKSAHAGADENAKLYCVYVAIGQKRSTVAQFVKVLEDQGALEYSIVIAATASDAA
PMQFIAPFAGCAMGEYFRDNGMHAVIVYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFY
LHSRLLERAAKMGDAAGNGSLTALPVIETQANDVSAYIPTNVISITDGQIFLETDLFYQG
VRPAVNVGLSVSRVGSSAQTKAMKKVAGKIKGELAQYREMAAFAQFGSDLDVSTQRLLNR
GARLTELLKQPQFSPLKMEEQVAVIYAGVNGYLDKLPVGKVRAFEEQLLGTLRSKHQDWL
NAVRDSKDLSDANANTLKGVVEATAKSFA
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggacatccgcgccgccgagatctccgcgatcctgaaagagcagatcaagaattttggc
caggaggccgaggtcacggaagtcgggcaggtgctcgcggtcggcgacggcatcgcccgc
gtctacggcctcgacaacgtccaggctggtgagatggtcgagttcgagtcgggcgtgcgc
ggcatggccctcaacctcgagcaggacaatgtcggcgtcgtgatcttcggctccgaccgt
gagatcaaggaaggccagaccgtcaagcggaccggctccatcgtggacgtgccggtcggc
aaaggcctgctcggccgcgtggtcgacggcctcggcaacccgatcgacggcaagggcccg
atccagtcgaccgagcgtcgccgcgtcgacgtgaaggcgccgggcatcatcccgcgcaag
tcggtgcacgagccgatgtccaccggcctcaaggcgatcgacgccctgatcccggtcggc
cgcggccagcgcgagctgatcatcggcgaccgccagaccggcaagaccgccatcgcgctc
gacaccattctcaaccagaagtcggcccatgccggtgcggacgagaacgccaagctctac
tgcgtctacgtcgccatcggccagaagcgctcgacggtggcccagttcgtgaaggtgctg
gaggaccagggcgccctggaatactccatcgtcatcgccgccaccgcctcggacgccgcg
ccgatgcagttcatcgcgccgttcgccggctgcgccatgggcgagtatttccgcgacaac
ggcatgcacgccgtgatcgtgtatgacgacctctccaagcaggccgtcgcctaccgccag
atgtcgctgctgctgcgccgcccgccgggccgcgaggcttacccgggcgacgtgttctac
ctccactcgcgcctgctcgagcgcgccgccaagatgggcgacgcggccggcaacggatcg
ctcaccgcgcttccggtgatcgagacccaggccaacgacgtctcggcctacatcccgacc
aacgtgatctcgatcaccgacggccagatcttcctcgagaccgacctgttctaccagggc
gtccgcccggcggtgaacgtcggcctctcggtctcgcgggtgggctcctcggcccagacc
aaggcgatgaaaaaggtcgccggcaagatcaagggtgagctggcgcagtaccgcgagatg
gcggccttcgcgcagttcggctcggatctcgacgtctcgacccagcgtctgctcaaccgc
ggcgcgcgcctcaccgagctcctgaagcagccgcaattctcgccgctgaagatggaagag
caggtcgcggtgatctacgccggcgtcaacggctacctcgacaagcttccggtgggcaag
gttcgcgccttcgaggagcagctcctcggcaccctgcgctcgaagcaccaggattggctg
aacgcggtgcgtgactccaaggacctgtcggacgccaacgccaacacgctcaagggcgtg
gtcgaggccaccgccaagtcgttcgcttaa

DBGET integrated database retrieval system