KEGG   Methylorubrum extorquens AM1: Mex_1p1550Help
Entry
Mex_1p1550        CDS       T00921                                 

Definition
(GenBank) putative amidotransferase; glutamine amidotransferase class-II domain
  KO
K22081  methylamine---glutamate N-methyltransferase subunit A [EC:2.1.1.21]
Organism
mea  Methylorubrum extorquens AM1
Pathway
mea00680  Methane metabolism
mea01100  Metabolic pathways
mea01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mea00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Mex_1p1550
Enzymes [BR:mea01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.21  methylamine---glutamate N-methyltransferase
     Mex_1p1550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_6 GATase_7 GATase_4
Motif
Other DBs
NCBI-ProteinID: ACS39412
UniProt: C5B062
LinkDB All DBs
Position
1624224..1625099
Genome map
AA seq 291 aa AA seqDB search
MLSKMLETMTDRGPDSAGFAVYGSDGASNAGSVKLTLRGPGPEALRGAVAKMEAALALSA
QATERDTHTVLAVPAEREAEIRAWLKDNTPGIDVVSAGRRMEIYKEVGLPASVAERFALE
GMSGTHGIGHTRMATESAVTTNGAHPFSTGTDECLVHNGSLSNHNDLRRRLRHEGLSFAT
QNDTEVAAGYLSWRMRGGASLKQALESSLTDLDGFFTFVVGTETGFAVVRDPIACKPAVM
AETDDYVAFGSEYRALVGLPGIDTARVFEPEPAKVYAWERTGSEHASGERQ
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgctttccaagatgctggagacgatgaccgatcgcggccccgacagcgcgggcttcgca
gtctacggctcggacggcgcctcgaatgccggcagcgtgaagctgaccctgcgcggcccc
ggcccggaggcgctgcgcggcgcggtcgcgaagatggaagcggcgctggccctctcggcg
caggcgaccgagcgcgacactcacaccgtcctcgccgttccagcggagcgcgaggccgag
attcgcgcttggctcaaggacaacacccccggcatcgacgtggtgagcgcgggccggcgc
atggagatctacaaggaagtcgggctgccggcttccgtggccgagcgcttcgccctggag
ggcatgtccggcacccacggcatcggccatacccgcatggccaccgagagcgcggtgacg
accaatggcgcccacccgttctcgacgggcaccgacgaatgcctcgtccataacggctcg
ctgtcgaaccacaacgacctgcgccgccgcctccgccacgagggcctgagcttcgccacc
cagaacgacaccgaggtcgccgccggctacctcagctggcgcatgcgcgggggcgcctcg
ctgaagcaggcgctcgaatcgagcctgaccgatctcgacggcttcttcaccttcgtggtc
ggcaccgagacgggcttcgccgtggtgcgcgaccccatcgcctgcaagcccgccgtgatg
gccgagaccgacgactacgtcgccttcggctcggaataccgggcgctggtcggcctgccc
ggcatcgacaccgcccgcgtgttcgagcccgagccggccaaggtctacgcgtgggagcgc
acaggttccgagcacgcttccggggagcgccagtga

DBGET integrated database retrieval system