KEGG   Methylobacterium extorquens AM1: Mex_1p1732Help
Entry
Mex_1p1732        CDS       T00921                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mea  Methylobacterium extorquens AM1
Pathway
mea00620  Pyruvate metabolism
mea00680  Methane metabolism
mea00710  Carbon fixation in photosynthetic organisms
mea01100  Metabolic pathways
mea01120  Microbial metabolism in diverse environments
mea01200  Carbon metabolism
Module
mea_M00168  CAM (Crassulacean acid metabolism), dark
mea_M00346  Formaldehyde assimilation, serine pathway
Brite
KEGG Orthology (KO) [BR:mea00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mex_1p1732 (ppc)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mex_1p1732 (ppc)
   00680 Methane metabolism
    Mex_1p1732 (ppc)
Enzymes [BR:mea01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Mex_1p1732 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ACS39576
UniProt: Q49136
LinkDB All DBs
Position
1805834..1808602
Genome map
AA seq 922 aa AA seqDB search
MTKTLHARPSAATDTTFAPPVITGTATEDALEILFHALLDVARRHDPELEDVLHGRADIS
SFTPEMLARALQVQGIWFQLVSIAEQNAAMRRRRHVERDQGREALNGSFAKVLAEASARG
IGPQQIHALLKDLRIRPTITAHPTEGKRVTVLEKLRRIYLVLRELELPRWTERERNGLMN
ELRDQIELIWMTGELHLEKATVEREVAWGLHFFDETLFEMLPEMLLSLEESLAQYYPDET
FEVPPFFQFGSWIGGDRDGNPYVTASVTRETLQRNALASLRRYRDGITHLGRVLSITERS
LPVPETFRSELAHMLAESGDARAIANRNPGEAYRQFLSCVLRKLEATIARNKGARSVGPD
YPSADGLINDLRTLEKGLADAKCGALATDIVRPVRRMVEIFRFSTVRLDLRENSTRTTKT
LHALWKLRNGDREPPALDSPAWKDWLLTELARPRTPETSFEDFADRLPDDARETLATFAL
VGEMRDTLDREAFGAFILSMTRSTVDVLGAYLLAKEAGIFLDTTGTEICPLPIVPLFETI
DDLRAAPAIMKELLGIPVVRRSTRWQGGVQEVMIGYSDSNKDGGFIASNWELYKAQVRLT
TLGNHLGVPIAFFHGRGGSVSRGGVPTHRGIAAQPPGSIQGRFRITEQGEVVSFKYANRG
TAAYQMELLAASVFEHALLSEGNGNGSRAEFDDALEALSGASRAAYVNLLQAEGLVDYFQ
AASPLDEISLLNIGSRPARRFGAKSLSDLRAIPWVFAWSQNRHVITGWYGVGSGLKSFID
VRGEAGEALLRRLFRDCRVFRLVLDEVEKTLLMVDLEIARDYAGLVEDAGIRARIFGMIE
AEYALTREMVLRVSGDSELAQRFPQFSERLRGRLPTINQVSREQVELLRRYRSETDEDKR
EAVKSALLLSINCIAVGFGATG
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagacgctgcacgcccggccgtcagccgcgaccgacacgaccttcgcgccgccg
gtcatcaccggcacggccaccgaggacgccctcgagattctgtttcacgccctgctcgac
gtggcccgccgccacgatcccgagctggaggacgtgctgcacggccgcgccgacatctcc
tccttcacgccggagatgctggcgcgcgcgcttcaggtgcagggcatctggtttcagctc
gtctcgatcgccgagcagaacgcggccatgcgccgccgccgccacgtcgagcgcgaccag
ggccgtgaggcgctgaacggctccttcgctaaggttctggccgaggcctccgcccggggc
atcggcccgcagcagatccacgcgctgctcaaggatctgcgcatccgcccgaccatcacc
gcgcatcccaccgagggcaagcgcgtgacggtgctggagaagctgcgccggatctacctc
gtgctgcgcgagctggaactgccgcgctggaccgagcgcgagcgcaacggcctgatgaac
gagctgcgtgaccagatcgagctgatctggatgacgggcgagctgcatctggagaaggcc
accgtcgagcgcgaggtcgcctgggggctgcacttcttcgacgagaccttgttcgagatg
ctgcccgagatgctgctctcgctcgaagagagcctcgcgcagtattatcccgacgagacc
ttcgaggtgccgccgttcttccagttcggaagctggatcggcggtgaccgcgacggcaac
ccctacgtcaccgccagcgtgacccgcgagacgcttcagcgcaacgcgctggcgtcgctc
cgccgttaccgcgacggcatcacccatctcggccgggtgctctcgatcaccgagcgctcg
ctgccggtgcccgagaccttccgcagcgaactcgcgcatatgctggccgagtccggcgac
gcgcgcgccatcgccaaccgcaatcccggcgaggcctatcgccagttcctctcctgcgtg
ctgcgcaagctcgaggcgacgatcgcccgcaacaagggcgcccgctcggtcggaccggat
tatccgagcgccgacgggctcatcaacgatctgcgcacgctggagaaggggctggccgac
gccaagtgcggcgcgctcgccaccgacatcgtgcggcccgtgcggcggatggtcgagatc
ttccgcttctccaccgtgcggctcgatctgcgcgagaactcgacccgcaccaccaagacg
ctgcacgcgctgtggaagctgcgcaacggcgaccgcgagccgccggcgctggattcgccg
gcctggaaggattggctgctcaccgagctggcccggccgcgcacgcccgaaacctcgttc
gaggatttcgccgaccgtctgcccgacgacgcgcgcgagacgctcgccaccttcgcgctg
gtcggcgagatgcgcgacactctcgaccgcgaggccttcggcgccttcatcctgtcgatg
acgcgctccaccgtcgacgtgctcggcgcctacctgctggccaaggaggccggcatcttc
ctcgacacgacgggcaccgagatctgcccgctgccgatcgtgccgctgttcgagaccatc
gacgacctgcgcgccgccccggcgatcatgaaggaactgctcggcatccccgtggtgcgc
cgctccacccgctggcagggcggggtgcaggaagtgatgatcggctactccgattccaac
aaggacggcggcttcattgcctcgaactgggagctctacaaggcgcaggtgcggctgacc
acgctcggcaaccatctcggcgtgccgatcgccttcttccacggccgcggcggttcggtg
agccgcggcggcgtgccgacccatcgcggcatcgcggcccagccgccgggctcgatccag
ggccgcttccgcatcaccgagcagggcgaagtcgtctcgttcaaatacgccaaccgcggc
accgccgcctaccagatggagctgctcgccgcctcggtgttcgagcacgccctgctctcg
gagggcaacggcaacggctcgcgcgccgaattcgacgacgcgctggaggcgctctcgggc
gcctcgcgggcggcctatgtcaacctgctccaggccgagggcctcgtcgattacttccag
gcggcgagcccgctcgacgagatctcgctgctcaatatcggctcgcgcccggcccggcgc
ttcggcgcgaagtcgctctcggatctgcgcgcgatcccctgggtgttcgcgtggtcgcag
aaccggcacgtcatcaccggctggtacggcgtcggctcggggctgaagagcttcatcgac
gtgcgcggcgaggcgggcgaagccctgctgaggcgcctgttccgggattgccgggtgttc
cgcctcgtcctcgacgaggtcgagaagacgctgctgatggtcgatctcgagatcgcccgc
gactatgccggcctcgtcgaggacgcgggcatccgcgcgcgcatcttcgggatgatcgag
gcggaatacgcgctgacgcgggagatggtcctgcgggtgtccggcgacagcgaactcgcc
cagcgcttcccgcaattcagcgaacgcctgcgcgggcggctgccgaccatcaatcaggtc
agccgcgagcaggtcgagctgctgcgccgctaccgcagcgagaccgacgaggacaagcgc
gaggcggtgaagtccgcgctgctgctgtcgatcaactgcatcgccgtcggcttcggcgcg
actggataa

DBGET integrated database retrieval system