KEGG   Methylorubrum extorquens AM1: Mex_1p3652Help
Entry
Mex_1p3652        CDS       T00921                                 

Gene name
aldA
Definition
(GenBank) aldehyde dehydrogenase; chloroacetaldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
mea  Methylorubrum extorquens AM1
Pathway
mea00010  Glycolysis / Gluconeogenesis
mea00620  Pyruvate metabolism
mea01100  Metabolic pathways
mea01110  Biosynthesis of secondary metabolites
mea01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mea00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mex_1p3652 (aldA)
   00620 Pyruvate metabolism
    Mex_1p3652 (aldA)
Enzymes [BR:mea01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Mex_1p3652 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ACS41363
UniProt: C5AZ51
LinkDB All DBs
Position
3795059..3796582
Genome map
AA seq 507 aa AA seqDB search
MNKPEFLADAKTKSPFSARYDNFIGGQWVAPASGRYFENTSPITGKVICEVARSEAADIE
RALDAAHAAKDAWGRTAPAERARILNKIADRMEDNLDLIALAETWDNGKPIRETTAADIP
LAIDHWRYFASCVRAQEGAISEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPAI
AAGNCVVLKPAEQTPASILVVMELIGDLLPPGVINVVNGFGLEAGKPLASNPRIAKIAFT
GETTTGRLIMQYASQNLIPVTLEFGGKSPNIFFGDVVNEDDDFFDKALEGFTMFALNQGE
VCTCPSRALVHESIYDRFIERAIKRVEAITQGSPLDPATMIGAQASSEQLEKILSYVDIG
RQEGAECLTGGARGTREGDLADGFYMQPTVFKGHNKMRIFQEEIFGPVLSVTTFKDDEEA
LAIANDTLYGLGAGVWTRDGTRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRE
THKMMLDHYQQTKNMLVSYSSKKLGFF
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagcccgaattcctggcggatgccaagacgaagtcgccgttttcggcgcgctac
gacaacttcatcggcggccagtgggtcgcgccggcgagcggccgctacttcgagaacacc
tcccccatcaccggcaaggtgatctgcgaggtcgcccgctccgaggcggcggacatcgag
cgggcgctcgacgccgcgcacgccgccaaggatgcctggggccgcaccgcgccggccgag
cgcgcccgcatcctcaacaagatcgccgaccggatggaggacaacctcgatctgatcgcg
ctggccgagacctgggacaacggcaagccgatccgcgagaccaccgccgcggacatcccg
ctcgccatcgaccactggcgctacttcgccagttgcgtccgcgcccaggaaggcgcgatc
tccgagatcgaccacgacacggtagcctaccacttccacgagccgctcggcgtcgtcggc
cagatcatcccgtggaacttcccgatcctgatggcggtgtggaagctggctcccgcgatc
gccgccggcaactgtgtggtgctcaagcccgccgagcagacccccgcctcgatcctcgtg
gtgatggagctgatcggcgacctgctgccgcccggcgtcatcaacgtcgtcaacggcttc
ggcctggaggccggcaagccgctcgcctcgaacccgcgcatcgccaagatcgcgttcacc
ggtgagacgaccaccggccgcctcatcatgcagtacgcctcgcagaacctgatcccggtg
acgctggagttcggcggcaagtcgccgaacatcttcttcggggatgtcgtcaacgaggac
gacgacttcttcgacaaggcgctcgaaggcttcaccatgttcgccctcaaccagggcgaa
gtctgcacctgcccgagccgcgcgctcgtgcacgagtcgatctacgaccgcttcatcgag
cgcgcgatcaagcgcgtcgaggcgatcacccagggctcgccgctcgatccggccacgatg
atcggcgcgcaggcctcttcggagcagctcgagaagatcctcagctacgtcgatatcggc
cgccaggaaggcgccgagtgcctcacgggcggcgcccgcggcacccgcgagggcgatctg
gccgacggcttctacatgcagccgacggtgttcaagggccacaacaagatgcggatcttc
caggaggagatcttcgggcccgtcctctcggtgacgaccttcaaggacgacgaggaagcg
ctcgccatcgccaacgacacgctctacggcctcggcgccggcgtgtggacccgcgacgga
acccgcgcctaccgcttcggccgcgccatccaggccggccgcgtctggacgaactgctac
cacgcctacccggcgcacgcggccttcggcggctacaagcagtccggcatcggccgtgag
acccacaagatgatgctcgaccactaccagcagaccaagaacatgctggtcagctactcc
tcgaagaagctcgggttcttctaa

DBGET integrated database retrieval system