KEGG   Methylorubrum extorquens AM1: Mex_1p3861Help
Entry
Mex_1p3861        CDS       T00921                                 

Gene name
sdhA_B
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mea  Methylorubrum extorquens AM1
Pathway
mea00020  Citrate cycle (TCA cycle)
mea00190  Oxidative phosphorylation
mea00650  Butanoate metabolism
mea01100  Metabolic pathways
mea01110  Biosynthesis of secondary metabolites
mea01120  Microbial metabolism in diverse environments
mea01130  Biosynthesis of antibiotics
mea01200  Carbon metabolism
Module
mea_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mea_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mea_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mea00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mex_1p3861 (sdhA_B)
   00650 Butanoate metabolism
    Mex_1p3861 (sdhA_B)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Mex_1p3861 (sdhA_B)
Enzymes [BR:mea01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Mex_1p3861 (sdhA_B)
    1.3.5.4  fumarate reductase (quinol)
     Mex_1p3861 (sdhA_B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-ProteinID: ACS41551
UniProt: C5B0G4
LinkDB All DBs
Position
3971121..3972938
Genome map
AA seq 605 aa AA seqDB search
MASNGTNGGAPAYAIIDHTFDVVIVGAGGAGLRATVGCSQAGLRTACITKVFPTRSHTVA
AQGGISASLGNMGPDDWRWHMYDTVKGSDWLGDQDAIEYLVRNAPAAVYELEHWGVPFSR
TDEGKIYQRPFGGMTTDYGKGTAQRTCAAADRTGHAMLHTLYGQAVKNKTQFFIEYFALD
LIMDEDGRCRGVLAIDQATGEIHRFRAQQTILATGGYGRAYFSATSAHTCTGDGNAMVLR
AGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLTNSEGERFMERYAPSAKDLASRDV
VSRSMTMEIRDGRGVGKEGDHIFLHLDHLDPKILHERLPGISESAKIFAGVDVTKEPIPV
LPTVHYNMGGIPTNFHGEVLTLKNGNPDTVVPGLMALGEAACVSVHGANRLGSNSLIDLV
VFGRAAGLRCADIVEPDARQPELPKGSADKALTRLDRFRYADGGTPTAQLRDRMQRTMQN
NCAVFRTGEVLEEGKGLIHEVWRGVSDIAITDRSLVWNTDLLETLEFDNLIGQAVVTMES
AVNRKESRGAHAREDFPDRDDKEWMKHTLAWLDQSKHGVEIDYRPVHTYTMSNDIQYIEP
KARVY
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggcctccaacggaacgaacggcggcgcgcccgcctacgccatcatcgaccacaccttc
gacgtggtgatcgtcggcgccggcggcgcgggcctgcgcgccacggtcggctgctcccag
gccggcctgcgcaccgcctgcatcaccaaggtgtttccgacccgctcgcacaccgtggcg
gcgcagggcggcatctccgcctcgctcggcaatatggggccggacgattggcgctggcac
atgtacgacaccgtgaagggctcggactggctcggcgaccaggacgcgatcgagtacctc
gttcgcaacgcccccgccgccgtctacgaactcgagcactggggcgtgcccttctcccgc
acggacgagggcaagatctaccagcggcccttcgggggcatgaccaccgattacggcaag
ggcaccgcccagcgcacctgcgccgcggccgaccgcaccggccacgccatgctccatacg
ctctacgggcaggcggtgaagaacaagacccagttcttcatcgagtacttcgccctcgac
ctgatcatggacgaggacggccgctgccgcggtgtgctggcgatcgaccaggccaccggc
gagatccaccgcttccgcgcccagcagaccattctcgccaccggcggctacggccgcgcc
tacttctcggcgacctcggcccatacctgcaccggtgacggcaatgccatggtgctgcgc
gccggcctgccgctgcaggacatggagttcgtgcagttccaccccaccggcatctacggc
gccggctgcctcatcacggagggcgcgcgcggcgagggcggctacctcaccaactccgag
ggcgagcgcttcatggagcgctacgccccctctgccaaggacctcgcctcccgcgacgtg
gtctcccgctccatgaccatggagatccgcgacggccgcggcgtgggcaaggaaggcgac
cacatcttcctgcatctcgaccatctcgacccgaagatcctgcacgagcgcctgccgggc
atctcggagagcgcaaagatcttcgcgggcgtggacgtgaccaaggagccgatcccggtc
ctgccgacggtccactacaacatgggcggcatcccgacgaacttccacggcgaggtgctg
accctgaagaacggcaaccccgacacggtggtgccgggcctgatggcgctcggcgaggcg
gcctgcgtctcggtgcacggcgccaaccgcctcggctcgaactcgctgatcgacctcgtg
gtgttcggccgcgccgcgggcctgcgctgcgccgacatcgtcgagcccgacgcccgccag
ccggaactgccgaagggctcggccgacaaggcgctcacgcgcctcgaccgcttccgctac
gccgacggcggcaccccgaccgcgcagctgcgcgaccggatgcagcggacgatgcagaac
aactgcgccgtcttccgcaccggcgaggtgctggaggagggcaagggcctgatccacgag
gtctggcgcggcgtctccgacatcgccatcaccgaccgttcgctggtgtggaacaccgat
ctgctcgaaaccctggaattcgacaacctgatcggtcaggcagtcgtgaccatggaatcg
gcggtcaaccgcaaggaaagccgcggcgcgcatgcccgcgaggacttccccgaccgcgac
gacaaggagtggatgaagcacacgctcgcgtggctcgaccaatccaagcacggcgtggag
atcgattaccgcccggtccacacctacacgatgtcgaacgacatccagtacatcgagccg
aaggcgcgggtgtactga

DBGET integrated database retrieval system