KEGG   Methylorubrum extorquens AM1: Mex_1p4414Help
Entry
Mex_1p4414        CDS       T00921                                 

Definition
(GenBank) putative glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mea  Methylorubrum extorquens AM1
Pathway
mea00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mea00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Mex_1p4414
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mea02000]
    Mex_1p4414
Enzymes [BR:mea01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Mex_1p4414
Transporters [BR:mea02000]
 Other Transporters
  Pores ion channels [TC:1]
   Mex_1p4414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C GST_C_3 Tom37
Motif
Other DBs
NCBI-ProteinID: ACS42045
UniProt: C5B315
LinkDB All DBs
Position
complement(4508878..4509519)
Genome map
AA seq 213 aa AA seqDB search
MSDDLVFYTNPMSRGRIVRWMLEEVGAPYRTEILGYGTSMKAPAYRAINPMGKVPALRHG
ATVVTECPAILAYLADAFPQAGLAPAPGHRDRGPYYRWLFFCAGPLEAAVTNGVLKVSVP
DDPRMQGMVGYGSLETALDTLETAVSGVEFVAGDRFSAADLYVAAHLGWGMQFGTIPKRP
AFEAYAGRHLAREAAARARAIDDALLAEAQAAS
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgatctcgtcttctacaccaacccgatgtcccgcggccggatcgtccgctgg
atgctggaagaggtcggcgcgccctaccgcaccgagatcctcggctatggcacctccatg
aaggcgccggcctaccgggcgatcaacccgatggggaaggtgccggcgctgcgccacggc
gcgacggtggtgaccgagtgccccgcgatcctcgcctatctcgccgacgccttcccgcag
gccggcctcgcccccgcgccgggccaccgcgaccgcggcccctattaccgctggctgttc
ttctgcgccgggccgctcgaggcggcggtcacgaacggcgtgctcaaggtgagcgtcccc
gacgacccgcgcatgcagggcatggtcggctacggcagcctggagacggccctcgacacg
ctcgaaacagccgtctccggggtggagttcgtggcgggcgaccggttcagcgccgccgac
ctctacgtcgccgcgcatctcggctggggcatgcagttcggtacgatcccgaagcgcccg
gccttcgaggcctatgccgggcgccacctcgcccgcgaggcggccgcgcgggcgcgggcg
atcgatgacgctttgctcgccgaggcgcaggcggcgtcatag

DBGET integrated database retrieval system