KEGG   Candidatus Methanoplasma termitum: Mpt1_c10110Help
Entry
Mpt1_c10110       CDS       T03540                                 

Gene name
mjaIIIR
Definition
(GenBank) type-2 restriction enzyme MjaIII
Organism
mear  Candidatus Methanoplasma termitum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII EcoRII-C
Motif
Other DBs
NCBI-ProteinID: AIZ56883
UniProt: A0A0A7LCZ6
LinkDB All DBs
Position
1037662..1038522
Genome map
AA seq 286 aa AA seqDB search
MTSKRDFDEWFSHFRRTIYGYSYYVDFNKVIGNVNAIKIELNLMNSLVGSKNIKADFIAL
AKKYPEILKTIPVLIAVREKEIEIMDEQAKNITYDFNKRNLSAEDYSVFLEKTGLFDLIS
KHIISNLNDYVTGVETGLDSNARKNRGGSAMENLVEKYLKASGCEYYVQMSASTINKKWG
INISGLSTDSKAEKKFDFVVKHRNEVFGIEVNFYASGGSKLNETARSYKMVAAESKQIDR
FNFIWVTDGGGWHSARNNLKETFETMEHIYSIADLENGVLNALFKP
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgacttcaaaaagagactttgatgaatggttctctcacttccgccgtaccatctatggc
tatagctattatgtggatttcaacaaagttattggaaatgttaatgccataaaaatagaa
ctcaatctgatgaattctctggtaggctccaaaaatataaaagcggattttattgcattg
gcaaaaaaatatcctgagatattaaagacaataccagttcttattgcagtaagagagaaa
gaaattgagataatggatgagcaagcgaaaaacattacttatgatttcaacaaaagaaac
ctctcagcggaagattattcggtttttcttgagaaaactggattgttcgatttgatttcc
aagcacataatttcaaatctcaatgattatgtgacaggtgttgaaaccggattagattct
aacgccagaaaaaaccgtggcggctctgcgatggagaatctggtagaaaaatatctgaag
gcgtctgggtgtgaatattacgtgcagatgtctgcttcaaccattaacaaaaaatggggg
attaatatatccgggctttccacagatagcaaagcagagaaaaaatttgattttgttgtg
aaacacaggaatgaagtgttcggtatcgaggttaacttctatgccagcggaggttctaaa
ttgaatgagaccgcccgcagttacaaaatggtggctgccgaatctaaacagattgacagg
ttcaacttcatatgggtcacagatggtggtggctggcacagtgccagaaataaccttaag
gagacttttgagacgatggaacacatttattcaattgcagatctggagaatggtgtattg
aacgctttgttcaaaccgtga

DBGET integrated database retrieval system