KEGG   Methylophaga frappieri: Q7C_1526
Entry
Q7C_1526          CDS       T02056                                 

Definition
(GenBank) PilL protein
Organism
mec  Methylophaga frappieri
SSDB
Other DBs
NCBI-ProteinID: AFJ02675
UniProt: I1YID2
LinkDB
Position
1535999..1536406
AA seq 135 aa
MAAERPVTTMTTLTQTSRYSVMVAQPTAGQRDLLSVTRAITIPGDIDSVGEAFHWMLRDS
GYRLAADAVLSEEAKAMLALPLPAVHRRFEPMPLQTVMGLMIGPAFHLIQDPVHRLIAFE
RCVDISSPNVTGGAQ
NT seq 408 nt   +upstreamnt  +downstreamnt
gtggcggccgagcggcccgtcacaacaatgaccacactgacccaaacgagtcgctattca
gtgatggtcgctcagccgaccgccgggcagcgggatctgttatcggtgacgagagcgatc
acgattccaggcgacatcgacagtgtgggggaggctttccactggatgttgcgagattcc
ggctatcgcctggcggccgatgctgtgctgtcggaggaggcgaaagccatgctggcgctg
ccactgccagcggtgcatcgccgctttgagcccatgccacttcaaaccgtgatgggactt
atgatcggtcctgcttttcatctcatccaggatcccgttcaccgcctcattgcgttcgag
cgttgcgtggatatttcttcccccaatgtgacgggaggtgcgcagtaa

DBGET integrated database retrieval system