KEGG   Methylophaga frappieri: Q7C_1539
Entry
Q7C_1539          CDS       T02056                                 

Definition
(GenBank) integrating conjugative element protein, PFL_4701 family
Organism
mec  Methylophaga frappieri
SSDB
Motif
Pfam: DUF3262 DUF2976 DUF4134 NVEALA
Other DBs
NCBI-ProteinID: AFJ02688
UniProt: I1YIE5
LinkDB
Position
1547361..1547591
AA seq 76 aa
MNAAQQTAFQAGSGITPATMLTAIASMVLVLAFVWVIWVALGTFRAWQEGQATLFDLTWS
TLRASIVLMVLGFYLR
NT seq 231 nt   +upstreamnt  +downstreamnt
atgaacgccgcacaacaaacagcctttcaagccggttccggtattaccccggccaccatg
ctgacggccatcgcgtcgatggtgttggtgttggcgtttgtctgggtgatttgggtagcg
ttaggaacttttcgggcctggcaggaagggcaggccacgctctttgatctgacctggagc
accctgcgggcaagcattgtgttgatggttttgggtttctatttgcggtga

DBGET integrated database retrieval system