KEGG   Methylophaga frappieri: Q7C_307Help
Entry
Q7C_307           CDS       T02056                                 

Definition
(GenBank) Alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mec  Methylophaga frappieri
Brite
KEGG Orthology (KO) [BR:mec00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Q7C_307
Enzymes [BR:mec01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Q7C_307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like Thioredoxin_3 FAD_binding_2 DAO FAD_binding_3 FAD_oxidored AlaDh_PNT_C K_oxygenase Thi4 NAD_binding_8 LIAS_N NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AFJ01486
UniProt: I1YEZ3
LinkDB All DBs
Position
complement(305962..307533)
Genome map
AA seq 523 aa AA seqDB search
MLDAKIAEQLKTYLQNLKRPVHLLASLNATQKAQEMRELLVEIADMSDFITLDDSDNNAR
QPSFRVKQPEGHEQIRFAGIPMGHEFTSLVLALLHVGGHPMKTEPEVIEQIRHLEGDLHF
ETYISLSCQNCPEVVQALNLMAAINPKISHTMIDGALFQEDVTEKQIMAVPTVYLNNKQF
AQGRTSLAEIIGKLDTGAVKREAEKISQKDPFDVLIIGGGPAGASASIYASRKGIRTGIV
AERFGGQVMDTLAIENFISVKATEGPQLVAALEEHVKDYDVDVMNLQRASKLRQKDKMIT
VELESGATLTSKSVIVATGARWRELGVPGEAEYRGHGVAYCPHCDGPLFKGKHVSVIGGG
NSGVEAAIDLAGIVGHVTLLEYNDQLKADAVLQKKLHSLDNVTVLIGAQTREITGADNKV
NGLNYEDRATGESHHLEVAGVFVQIGLLPNTDFLKDTLSLSKYGEIEIDAHGATSMPGVF
AAGDVTTIPYKQIIMAMGEGARAALGAFDYLIRTDFDDKDKAA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcaaaaattgcggaacaattaaaaacctatttgcaaaatttgaagcgtcca
gtccatttgctggcgtctctcaatgccactcaaaaagcgcaggaaatgcgtgaattactg
gtagaaattgcagatatgtccgattttattacactggatgacagtgataataacgcacgt
cagccatctttccgggttaaacaaccagaggggcacgagcaaatccgctttgctggtatt
ccgatgggacacgagtttacgtcattggttttggctttactgcatgtcggtggccatccg
atgaagaccgagcctgaagttatcgaacaaatacgtcatctcgaaggcgatttgcacttc
gagacttatatttcgctgtcttgccagaattgccctgaagttgttcaggcgctgaattta
atggcggcgattaatcccaagatcagccacaccatgattgatggtgcgctgttccaagaa
gacgtgaccgaaaagcaaatcatggcggtgccgacggtttacctgaataacaaacagttt
gctcagggtcgcacgagtctggcggaaattatcggcaaactggatacgggtgcagttaag
cgggaagcagaaaaaatcagtcagaaagatccgtttgatgtgttaatcatcggcggcggt
ccggcaggtgcttccgcgtccatttatgcttcgcgtaaaggcattcgaaccggtattgtt
gctgagcgcttcggtggtcaggtgatggacacgctcgctatcgaaaactttatttcggtc
aaggccactgaagggccgcaattagttgcggcgctggaagagcatgtgaaagattatgat
gtggatgtgatgaatctgcagcgtgctagtaagctgcgtcagaaagataaaatgatcacc
gtggaactggaaagcggtgcgacattgaccagtaaatcggtgattgtggccacaggtgcg
cgctggcgggagctcggtgtaccaggtgaggcggaatatcgtggtcacggcgttgcctac
tgcccgcactgtgatggtccgttatttaagggcaagcacgtgtcggttattggtggtggt
aattctggcgtagaagcagccattgatctggcaggtattgtgggtcatgtcactttgctc
gagtacaacgatcaattgaaggcagacgcagtcttgcagaaaaaactgcacagtctggat
aatgtcacggtgctgattggggctcaaactcgtgaaattacgggtgcggacaacaaagtc
aatggcttgaactatgaagatcgggcaaccggtgaaagccatcatctggaagtcgccggc
gtgttcgtccagattggtttattgccaaataccgactttttgaaagacacgttgtcattg
agcaaatatggcgaaatcgaaattgatgcgcatggtgccacctcaatgccgggtgtattt
gctgcaggggatgtcactaccattccatacaagcagattattatggcaatgggcgaaggt
gcacgagcagcattaggggcttttgattatctgattcgcaccgactttgacgacaaagac
aaagccgcataa

DBGET integrated database retrieval system