KEGG   Megasphaera elsdenii: MELS_0384Help
Entry
MELS_0384         CDS       T01633                                 

Definition
(GenBank) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
med  Megasphaera elsdenii
Pathway
med00010  Glycolysis / Gluconeogenesis
med00051  Fructose and mannose metabolism
med00052  Galactose metabolism
med00500  Starch and sucrose metabolism
med00520  Amino sugar and nucleotide sugar metabolism
med00521  Streptomycin biosynthesis
med01100  Metabolic pathways
med01110  Biosynthesis of secondary metabolites
med01120  Microbial metabolism in diverse environments
med01130  Biosynthesis of antibiotics
med01200  Carbon metabolism
Module
med_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
med_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:med00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MELS_0384
   00051 Fructose and mannose metabolism
    MELS_0384
   00052 Galactose metabolism
    MELS_0384
   00500 Starch and sucrose metabolism
    MELS_0384
   00520 Amino sugar and nucleotide sugar metabolism
    MELS_0384
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MELS_0384
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MELS_0384
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:med04131]
    MELS_0384
Enzymes [BR:med01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     MELS_0384
Membrane trafficking [BR:med04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    MELS_0384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_1 Hexokinase_2
Motif
Other DBs
NCBI-ProteinID: CCC72607
UniProt: G0VM45
LinkDB All DBs
Position
complement(437960..439204)
Genome map
AA seq 414 aa AA seqDB search
MADTIKNWESMRQALQLSGAELRELAQHFRKDAEDALAGKSSSLSALRTYLGLPTGREMG
TFLALDFGGTNVRASRIRLMGEQGFVVERKVAKPLKCADYDYTCSSTTAEELFDFIAAIV
KEAADGNQDYKLGFTFSFAVDQTSAKDARLIAWSKEIAVPGVAGKPINGLLKEALVRAGL
DRIEPVALLNDTTATLLSSVYQHNPSHIGIVCGTGFNMCYYEPALQMIVNLEAAGFDGAP
ATVWDRLVDEASQQPGDHPFEKMIGGRYLSEVCRAVFGEYLKKAIPEFTTRDMNELISGQ
KTAEAILGFAVSEEEQEWLCALVRAVFARAARLIGAASFGILSHLAQGKGVTEQSIAIEG
SLVEKIKGVPSLIEDAICIFCMAPTENTRIHVAPNSNGASVGAAIAAALSCYKL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggcagacacgataaaaaattgggaatcaatgagacaggctttgcagctatccggcgcg
gaactgcgggaactagcacagcacttccggaaggacgctgaagacgccttggccgggaag
tcgagttccctttctgccctgcgcacctatctgggcttgccgacgggacgggaaatgggg
acgttcttagccctggatttcggcggtaccaatgtccgggcttcgcgcatccgccttatg
ggagaacagggctttgtcgtagaacgtaaggtggccaaacccttgaaatgtgccgactat
gactatacctgttcatcgacgacggcagaagaactcttcgatttcatcgccgccatcgtc
aaagaagcggctgatggcaatcaggactataaattgggctttaccttttcttttgctgtt
gaccagacgtcagctaaggatgcccgtctcatcgcctggtctaaggaaatcgccgttccc
ggcgtcgctggcaagcccatcaacggcctgctgaaagaagccctggtccgggccggcctg
gaccgcatcgaaccggtggccctgctcaacgatacgacggcgaccctgttatcttctgtt
tatcagcataacccgtcgcatatcggcatcgtctgcggcacgggtttcaacatgtgttat
tatgaaccggccctgcagatgatcgtcaacctggaagcggccggcttcgatggcgccccg
gcgacagtctgggaccgcctcgtcgatgaagcgtcccagcagcctggagaccatcccttt
gaaaagatgattggcggccggtatttgagcgaagtctgccgtgccgtctttggtgaatac
cttaaaaaggcgattcctgagttcacgacgcgcgatatgaacgaactcatttccggtcag
aagacggccgaagctatcctgggatttgccgtcagtgaggaagaacaagaatggctctgt
gccctggttcgggctgtctttgcccgggcagcccggctcatcggggcggccagcttcggg
atcctcagccacctggctcaggggaagggggttacggaacagtccatcgccatcgaaggc
agcctggtcgaaaagatcaaaggggtgccgtccctcatcgaagatgctatctgcatcttc
tgcatggcaccgactgaaaatacccgcatccatgtagcccccaacagcaacggtgcgtcc
gtaggagccgccatcgctgcggcgctttcgtgctacaaactttga

DBGET integrated database retrieval system