KEGG   Megasphaera elsdenii: MELS_1168Help
Entry
MELS_1168         CDS       T01633                                 

Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
med  Megasphaera elsdenii
Pathway
med00471  D-Glutamine and D-glutamate metabolism
med00550  Peptidoglycan biosynthesis
med01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:med00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    MELS_1168
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MELS_1168
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:med01011]
    MELS_1168
Enzymes [BR:med01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     MELS_1168
Peptidoglycan biosynthesis and degradation proteins [BR:med01011]
 Precursor biosynthesis
  Amino acid ligase
   MELS_1168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: CCC73390
UniProt: G0VPL2
LinkDB All DBs
Position
1294659..1296047
Genome map
AA seq 462 aa AA seqDB search
MVNLNEVTNVHFIGIAGAGMRAIANVFIEKGYHVSGSDLKASPVTEQFAKKGARICIGQR
PENLKDAQVVVISSAIRDTNVELAEARRRGIPVIHRSDALVHIMSWGKGISVAGAHGKTT
TSSMLGQVFEECHQDPTIVIGGEVDYLHSNSILGKGPYVIAEADESDGTFLKQNPYIAVV
TNIDADHMDHYGSLDNVIDAFKQFIQKLDPQDGLAVLCFENDKIRALAPKTERRYVSYGL
EQPADYQAKDLHYIKGKLHFSVYKHGEKMGDMVLNVPGRHNVLNALATTAVADACGLPFE
GIASAMSHFHGAKRRFQTKGFVGDVWVVDDYAHHPTEINATLTAARDMGTHRVVCLFQPH
RYTRTKLLLDQYGSAFAKADKLIITDVYSAGEDPIPGVSGELIARKVKETTGQDVTYIPH
KEDLVAYLKENSRPLDLVITMGAGDIYKVGEAYLAEAKEMEK
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggttaatctgaacgaggttacaaacgttcattttatcggcattgccggcgccggaatg
cgggcaattgccaatgttttcattgaaaaaggatatcatgtatccggttcggatctcaaa
gcgtcgccggtgacggaacagttcgcgaaaaaaggggcccgtatctgcatcggccagcgt
ccggaaaatctgaaggatgcccaggtcgtcgtcatttcgtcggccatccgcgatactaac
gtagaactggccgaagcgcgccgccgcgggattccggtcatccatcggtccgatgccctg
gtccacatcatgagctgggggaaggggatttctgtagccggtgcccatggcaagacgacg
acgtcgtccatgctgggccaggtcttcgaagaatgtcatcaggacccgaccatcgtcatc
ggcggcgaagtcgattacctgcatagcaattccatcctggggaaaggcccttatgttatt
gccgaagccgatgaaagcgatgggactttcctcaagcagaacccttatattgccgtcgtc
accaatatcgacgccgaccatatggaccattatggctcgctggacaacgtcatcgacgcc
ttcaagcagttcatccagaagctcgatccccaggatggcctggctgtcctgtgctttgaa
aacgataagatccgggccctggctccgaagacggaacggcgttatgtatcgtatggcctt
gaacagccggcggactatcaggccaaagaccttcattacatcaagggcaagctccatttc
tccgtctataagcatggcgaaaaaatgggggacatggtcctcaacgtaccggggcgccat
aacgtcctcaacgcactggcgacaacagccgtcgccgatgcctgcggccttccctttgaa
ggcatcgcttcggctatgagtcatttccacggtgccaaacggcgtttccagaccaagggc
tttgtcggcgacgtctgggtcgtcgatgattacgcccatcatccgacggaaatcaatgcg
accctgacagcagcccgcgatatggggacgcaccgcgtggtctgcctcttccagccgcat
cgctatacgcggacgaaactgctcctcgaccagtatggcagcgcctttgccaaggctgat
aagctcatcatcaccgacgtctacagtgccggtgaagaccccattcccggcgtgtcggga
gaactcattgcccggaaggtcaaggaaacgacagggcaggatgtcacctatatcccgcat
aaggaagatttagtggcttatttgaaggaaaattcccgtcccctcgacctggtcatcacc
atgggagccggagatatttataaagtcggcgaagcctatctcgctgaagctaaagaaatg
gagaaataa

DBGET integrated database retrieval system