KEGG   Megasphaera elsdenii: MELS_1685Help
Entry
MELS_1685         CDS       T01633                                 

Definition
(GenBank) cystathionine beta-lyase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
med  Megasphaera elsdenii
Pathway
med00270  Cysteine and methionine metabolism
med00450  Selenocompound metabolism
med01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:med00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    MELS_1685
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MELS_1685
Enzymes [BR:med01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     MELS_1685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_5 Aminotran_1_2 Met_gamma_lyase Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: CCC73904
UniProt: G0VRL4
LinkDB All DBs
Position
complement(1849213..1850409)
Genome map
AA seq 398 aa AA seqDB search
MAKKENKFKGYDISTQAVHTGVAYDAETGAVRRPLHMANSYKLPDDLSKVNYSSTDLLMY
ARNGNPNQHWLEEKVAALHGADDAIVLGSGVAALHALFWTLLKTGDRVVYPKVSYMAVYR
LFHELFNRKFGVETVMVDMTDLEAVKKAITPGTRLVHIETPDNPTDGISDIAAIAKIAHE
NGAALSVDNTFASPLNQHPLDFGADFVVESLTKYINGHGDAQGGAIISNDLATMDRIRYE
AQVNVGSVISPFNAWQIFRGAVTFPLRMERINASTQKIAEWLEQRQNVTFVSYPGLPSNP
GHELAKKQMKHGFGGVISFGIAADDKAVERFCAALKVVTFAVSLGHDESLIFPQPSYDER
INLYPEKFRKGFIRFSIGLEDPDDIIGDLNQALKAIGL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaaagaaaacaagttcaaggggtatgatatttcaacacaagccgtccatacg
ggcgtcgcttatgatgcggaaacaggagccgtccgccggccgctgcacatggccaatagc
tacaagctacccgatgacctgtcgaaggtcaattattcttcgacggatctgctgatgtac
gcccgcaatggcaacccgaatcagcactggctggaagaaaaagtcgctgccctccacgga
gccgatgacgccatcgttctgggaagcggcgtcgccgcccttcacgctttgttctggacg
ctgctcaagacaggcgaccgcgtcgtctatccgaaagtcagctatatggccgtctatcgc
ctgttccacgaattattcaaccggaaattcggcgtcgaaacagtcatggtcgatatgacg
gacctggaagccgtcaaaaaagcgattacgccagggacgcgcctggtccatatcgagacg
ccggacaatccaactgacggtatttcagacattgcggccattgccaaaatcgctcatgaa
aatggagcggccttgtctgtcgacaatacctttgcatcgcctctcaatcagcatcccttg
gatttcggcgctgactttgtcgtcgaatcgctgaccaaatatatcaacggccacggcgat
gcccaaggaggggctatcatttccaacgacttggcgacgatggaccggatccgctatgaa
gcccaggtcaatgtcggctctgtcatcagtcccttcaatgcctggcagatcttccgcggt
gccgtcaccttccctttgcggatggaacgcatcaatgcgtcgacgcaaaaaatcgcagaa
tggctggaacagcgccaaaacgtcacgttcgtttcctatcccggcctgcccagcaaccct
ggccacgaattggccaaaaagcagatgaaacacggttttggcggcgttatttcttttggc
atcgctgctgacgacaaggcggtcgaacggttctgcgcggccttgaaagtcgtcaccttt
gccgtctccctcggccatgacgaaagcctgattttcccgcagccgagctacgatgaacgc
atcaatctctatccggaaaaattccgcaagggcttcatccgcttcagcatcggcctggaa
gatccggacgacatcatcggcgacctcaatcaggccttgaaagccatcggcttataa

DBGET integrated database retrieval system