KEGG   Megasphaera elsdenii: MELS_1904
Entry
MELS_1904         CDS       T01633                                 

Definition
(GenBank) ATP synthase F0
  KO
K02110  F-type H+-transporting ATPase subunit c
Organism
med  Megasphaera elsdenii
Pathway
med00190  Oxidative phosphorylation
med01100  Metabolic pathways
Module
med_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:med00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MELS_1904
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:med00194]
    MELS_1904
Photosynthesis proteins [BR:med00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   MELS_1904
SSDB
Motif
Pfam: ATP-synt_C
Other DBs
NCBI-ProteinID: CCC74122
UniProt: G0VS82
LinkDB
Position
complement(2096687..2096944)
AA seq 85 aa
MEKALVLALSAFGACLGIGLAALGAAIGDGHAASKMLEGTARQPEMGGKLLVNMLISIGL
IESMPIIAAVIAIVLVFANPFVSLL
NT seq 258 nt   +upstreamnt  +downstreamnt
atggaaaaagctctcgtattggcattatctgcatttggtgcatgcttaggtattggtttg
gcagccctcggcgctgctatcggtgacggccacgctgcttcgaagatgctcgaaggtaca
gcccgtcagccggaaatgggcggcaagctcctcgtaaacatgcttatctccatcggcctg
atcgaatccatgccgattatcgcagctgtcatcgctatcgtattggtcttcgccaatccg
ttcgtcagcctgctctaa

DBGET integrated database retrieval system