KEGG   Methylobacterium currus: DA075_01465Help
Entry
DA075_01465       CDS       T05184                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mee  Methylobacterium currus
Pathway
mee00564  Glycerophospholipid metabolism
mee01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mee00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DA075_01465
Enzymes [BR:mee01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DA075_01465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 FAD_oxidored FAD_binding_3 Pyr_redox_2 STPPase_N 3HCDH_N GIDA
Motif
Other DBs
NCBI-ProteinID: AWB24611
UniProt: A0A2R4WST6
LinkDB All DBs
Position
1:313270..314817
Genome map
AA seq 515 aa AA seqDB search
MAPRRQQPGDERGVFDLAVIGGGINGCGIARDAVGRGASVVLFEQNDLASGTSSTSTKLI
HGGLRYLEHYEFRLVREALMEREVLWGMAPHIVWPLRFVLPHHAGLRPGWLLRLGLLLYD
NLGGRKRLPGTRTLDLTRDPAGEPLKPGFRRAFEYSDCWVEDSRLVVLNARDAAERGAVI
RPRTRVVTATRSEGLWEVTVEDRQTGARDTVRARTLVNAAGPWVANVLTGVARANSTEGV
RLVQGSHIVVRRLFKHDRAYIFQNADQRIIFAIPYERDFTLIGTTDRDYKGDPADVKASE
EEIAYLCAAASEYFRDPVTRDEVVWTYSGVRPLYDDGASKAQEATRDYVLTLDAPEGQPA
MLSVFGGKITTYRRLAEAALDRLKDHLPAARKSAWTAGAVLPGGNFPKESYDDVVAGLAR
QHPGVPEALVARLVRAYGTEAREILSGARGLADLGRLFGADLTEREVRHLMRREWASTAD
DVLWRRSKLGLRVAPAEAAALDDFMRRAAAAPNAA
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
ttggcccccaggcgtcagcagcccggcgacgagcgcggggtgttcgacctcgcggtgatc
ggcggcggcatcaatggctgcggcatcgcccgcgacgcggtgggccgcggcgcctcggtg
gtgctgttcgagcagaacgacctggccagcggcacgtcctcgacctcgaccaagctgatc
cacggcggcttgcgctacctcgaacactacgagttccgcctggtgcgcgaggccctgatg
gagcgcgaggtcctgtggggcatggcgccccacatcgtctggccgctgcgcttcgtgctg
ccgcatcatgcgggcctgcggcccggctggctcctgcgcctcggcctcctgctctacgac
aacctcggcggccgcaagcgcctgcccggcacccgcaccctcgacctcacccgcgatccc
gccggcgagccgctgaagcccggctttcgccgcgctttcgaatattcggattgctgggtg
gaggattcgcgcctcgtggtgctgaatgcccgcgacgccgccgagcgcggcgcggtgatc
cgcccgcgcacccgggtcgtcaccgcgacccgcagcgagggcctgtgggaggtcaccgtc
gaggaccgccagaccggcgcccgcgacaccgtgcgggcccgcaccctcgtcaacgccgcc
gggccctgggtcgccaacgtgctcaccggcgtggcgcgggcgaactcgaccgagggcgtg
cgtctggtccagggcagccacatcgtggtgcggcgcctcttcaagcacgaccgcgcctac
atcttccaaaatgccgaccagcgcatcatcttcgcgattccttacgagcgcgacttcacg
ctgatcggcaccaccgaccgcgactacaagggcgaccccgccgacgtgaaggcgagcgag
gaggagatcgcctatctctgcgctgccgccagcgagtatttccgcgatcccgtcacccgc
gacgaggtggtgtggacctattcgggcgtgcgcccgctctacgacgacggcgcgtcgaag
gcccaggaagccacccgcgactacgtgctgaccctcgacgcgccggagggacagccggcg
atgctctcggtcttcggcggcaagatcaccacctatcggcgcctcgccgaagcggcgctc
gaccgcctgaaggaccatctgccggccgcccgaaagagcgcctggaccgcgggcgccgtc
ctgccgggcggcaacttcccgaaggagagctacgacgacgtcgtggcgggcctcgcgcgc
cagcatccgggggtgccggaggcgctggtcgcccggctggtgcgggcctacggcaccgag
gcgcgggagatcctgagcggcgcccgcggactcgccgatctcggccgcctcttcggcgcc
gacctcaccgagcgcgaggtgcgccacctgatgcgccgcgaatgggcgtcgaccgccgac
gacgtgctctggcgccgctcgaaactcggccttagggtcgcgccggccgaggccgccgcc
ctcgacgacttcatgcgccgcgccgccgccgcccccaacgcggcctga

DBGET integrated database retrieval system