KEGG   Methylobacterium currus: DA075_02115Help
Entry
DA075_02115       CDS       T05184                                 

Definition
(GenBank) L-idonate 5-dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
mee  Methylobacterium currus
Brite
KEGG Orthology (KO) [BR:mee00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DA075_02115
Enzymes [BR:mee01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     DA075_02115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Methyltransf_25 Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: AWB19882
UniProt: A0A2R4WEB9
LinkDB All DBs
Position
1:452135..453175
Genome map
AA seq 346 aa AA seqDB search
MTLAARIHAAKDLRVEAISLREPEADEVVVALGAGGICGSDLSYYGKGRVGDFSLREPMV
LGHEVAGTVERVGAAVTSVKPGDRVAVDPSRPCLSCDYCRAGRSNLCRNMRFFGSAAIYP
HVQGGFSELFLARADQCVVVPDAMPMRVAACGEPLAVALHGVRRAGELLGRHVLIAGAGP
IGLLCLMAAKLAGARRIVCTDLSDAPLGIAREIGAAETINVGTQPERLASYEADKGTFDV
ALEATGSPAALASLFRVVRPGGRVVQLGMMPPGDVPVPANMLMAREIDFIGAFRFHEEYR
TAIALLAAGRIDVGPILSAEMPMARADEAFALAADRSRAIKVHLAF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcgccgcgcgcatccacgccgccaaggacctgcgggtcgaggcgatctcgctc
cgcgagccggaggcggacgaggtcgtggtcgcgctcggcgccggcggcatctgcggctcg
gacctgtcctattacggcaagggccgggtcggcgacttctcgttgcgcgagccgatggtg
ctcggccacgaggtcgccggcacggtggagcgcgtgggcgccgccgtcacgagcgtgaag
cccggcgaccgggtcgcggtcgatccgagccggccctgcctctcctgcgactattgccgc
gccggccgctcgaacctgtgccgcaacatgcgcttcttcggctcggcggcgatctatccg
catgtccagggcggcttcagcgagctcttcctcgcccgggccgaccagtgcgtggtggtg
ccggatgcgatgccgatgcgggtcgcggcctgcggagagcccctggcggtggcgctccac
ggcgtgcggcgggcgggcgagcttctgggccgccacgtcctcatcgccggggccgggccg
atcggcctcctgtgcctgatggcggcgaagctcgccggcgcccgccggatcgtctgcacc
gacctgtccgatgcgccacttggcatcgcccgggagatcggcgccgccgagaccatcaac
gtcggcacgcagccggagcggctggcctcctacgaggccgacaagggcaccttcgacgtc
gccctcgaagccaccggctcgcccgcggccctcgcctcgctcttccgggtggtgcggccc
ggcggccgggtggtgcagctcggcatgatgccgccgggcgacgtcccggtgccggccaac
atgctgatggcccgcgagatcgacttcatcggcgccttccgcttccacgaggagtaccgc
accgccatcgccctgctggccgccggccggatcgatgtcgggccgatcctctccgccgag
atgccgatggcccgggccgacgaagcctttgccctcgccgccgaccgcagccgggcgatc
aaggtccacctcgctttctag

DBGET integrated database retrieval system