KEGG   Methylobacterium currus: DA075_09015Help
Entry
DA075_09015       CDS       T05184                                 

Definition
(GenBank) beta-ketoacyl-ACP synthase I
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
mee  Methylobacterium currus
Pathway
mee00061  Fatty acid biosynthesis
mee00780  Biotin metabolism
mee01100  Metabolic pathways
mee01212  Fatty acid metabolism
Module
mee_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mee00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DA075_09015
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DA075_09015
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mee01004]
    DA075_09015
Enzymes [BR:mee01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     DA075_09015
Lipid biosynthesis proteins [BR:mee01004]
 Fatty acid synthase
  Component type
   DA075_09015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: AWB21027
UniProt: A0A2R4WHM3
LinkDB All DBs
Position
1:1935680..1936906
Genome map
AA seq 408 aa AA seqDB search
MRRVAITGMGIVSSIGNSTQEVLASLREARSGISRAEDFAAHGFRSQVQGAPTLDAETVV
DRRAMRFHGGGTAWNHVAMEQAIRDAGLEQAEVSHERTGIIMGSGGPSTRALVEAADIAR
AKGPKRVGPFAVPKAMSSTASATLATWFKIRGVNYSISSACATSNHCIGNASEIIQAGRQ
DIIFAGGCEELDWTLSVLFDAMGAMSSKYNETPSRASRAYDRARDGFVIAGGAGVLVLEE
LEHARARGARIYGEVAGYGATSDGHDMVAPSGEGAVRCMRQAIEGLKGVKIDYINPHATS
TPVGDDKEIEAIREVFGTGESCPPIAATKSLTGHSLGATGVQEAIYSLLMMNNGFICESA
HIDELDPAFADMPILRARKDDAQLGHVLSNSFGFGGTNATLVLKHVDA
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgcgtggcaatcaccgggatgggcatcgtctcgtccatcggcaattccacccag
gaggttctggcgtccctccgcgaggcgcgctcgggcatctcccgcgctgaggacttcgcg
gcccacggcttccgcagccaggtccagggcgcacccaccctcgacgccgagacggtggtc
gaccgccgtgccatgcgcttccacggcggcggcaccgcctggaaccacgtcgcgatggag
caggcgatccgcgacgccggcctggagcaggccgaggtctcgcacgagcgcaccggcatc
atcatgggctcgggcggtccctcgacccgcgcgctcgtcgaggcggccgacatcgcccgc
gccaaggggccgaagcgcgtcgggcccttcgcggtgcccaaggcgatgtcctcgaccgcg
tcggcgacgctcgccacctggttcaagatccggggcgtgaactactcgatctcgtccgcc
tgcgcgacctcgaaccactgcatcggcaacgcctccgagatcatccaggccgggcgccag
gacatcatcttcgccggcggctgcgaggagctggactggaccctctcggtcctgttcgac
gccatgggggcgatgtcctcgaagtacaacgagaccccgtcgcgggcctcgcgcgcctat
gaccgggcgcgggacggcttcgtcatcgcgggcggcgccggcgtgctggtgctggaggag
ctggagcatgcccgcgcccgcggcgcgcgcatctacggcgaggtcgccggctacggcgcc
acttcggacggccacgacatggtggccccgtccggcgagggggcggtgcgctgcatgcgc
caggcgatcgaggggctcaagggcgtcaagatcgactacatcaacccccacgccacctcg
acccccgtcggcgacgacaaggagatcgaggcgatccgcgaggtgttcggcaccggcgaa
tcctgcccgccgatcgccgccaccaagtcgctgaccggccactcgctcggcgccaccggc
gtgcaggaggcgatctactcgctcctgatgatgaacaacggcttcatctgcgagagcgcc
catatcgacgagctcgatccggccttcgccgacatgccgatcctgcgcgcccgcaaggac
gacgcgcagctcggccatgtgctcagcaactccttcggcttcggcggcaccaacgccacc
ctggtcctgaagcacgtcgacgcctga

DBGET integrated database retrieval system