KEGG   Methylobacterium currus: DA075_20880Help
Entry
DA075_20880       CDS       T05184                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
mee  Methylobacterium currus
Pathway
mee00061  Fatty acid biosynthesis
mee00780  Biotin metabolism
mee01100  Metabolic pathways
mee01130  Biosynthesis of antibiotics
mee01212  Fatty acid metabolism
Module
mee_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mee00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DA075_20880
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DA075_20880
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    DA075_20880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mee01004]
    DA075_20880
Enzymes [BR:mee01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     DA075_20880
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     DA075_20880
Lipid biosynthesis proteins [BR:mee01004]
 Fatty acid synthase
  Component type
   DA075_20880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AWB24999
UniProt: A0A2R4WTY8
LinkDB All DBs
Position
1:4495919..4496701
Genome map
AA seq 260 aa AA seqDB search
MTQIPDGTALAGKRALILGVANEHSIAYGCARVFRRLGAQIALTYLNEKARPFVEPLARE
LDAPILVPCDVQKDGDLEGVFRQVAETWGGLDIALHAIAFAPAKDLQGRLVDSSREGFGI
AMDVSCHSFVRMARLAAPLMSGGGTLLTMSYHGANKVVPNYNLMGPVKAALESAVRYLAY
ELGDRGIRVHAVSPGPLKTRAASGLKDFDLLLNAAIQRAPIGELVDIDDVGLTAAFLTTP
YAARLTGTTVYVDGGLSIMA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagatccccgacggcaccgccctcgcgggcaagcgcgccctcatcctcggcgtc
gccaacgagcactcgatcgcctatggctgcgcccgggtcttccggcggctcggggcgcag
atcgccctgacctacctcaacgagaaggcgaggcccttcgtcgagccgctcgcgcgcgag
ctcgacgcgccaatcctcgtgccgtgcgacgtccagaaggacggggatctcgagggggtg
ttccggcaggtcgccgagacctggggagggctcgacatcgcgctccacgcgatcgccttc
gcgccggcgaaggatctgcagggccggctggtcgacagctcccgcgagggattcggcatc
gccatggacgtgtcctgccactccttcgtgcggatggcgcggctcgccgcgccgctgatg
agcgggggcggcacgctcctgacgatgagctaccacggcgccaacaaggtcgtgccgaac
tacaacctgatgggaccggtcaaggcggcgctggagagcgccgtgcgctacctcgcctac
gagctcggcgaccgcggcatccgcgtccacgccgtgtcgcccggccccctcaagacccgc
gccgcgtcgggcctcaaggatttcgacctcctcctcaacgcggcgatccagcgcgccccg
atcggcgagctcgtcgacatcgacgatgtcggcctcaccgccgccttcctgacgacgccc
tacgcggcccgtctcacgggcacgaccgtctacgtcgacggcggcctcagcatcatggcg
tga

DBGET integrated database retrieval system