KEGG   Methanosarcina sp. WH1: MSWH1_0079Help
Entry
MSWH1_0079        CDS       T03851                                 

Definition
(GenBank) Ribulose-1,5-bisphosphate carboxylase, Type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mef  Methanosarcina sp. WH1
Pathway
mef00630  Glyoxylate and dicarboxylate metabolism
mef01100  Metabolic pathways
mef01120  Microbial metabolism in diverse environments
mef01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MSWH1_0079
Enzymes [BR:mef01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MSWH1_0079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AKB20350
UniProt: A0A0E3NR47
LinkDB All DBs
Position
96826..98112
Genome map
AA seq 428 aa AA seqDB search
MRRDYIDRDYSPKDTDLICEFHIEPSAGVNFEEVATHMAGESSIDSWTEISTLSPELAVK
LKPHIFYLDEESQTVRVAYSEDLFELGSVPQVLSAVAGNIFSMKIVDNLRLQDIAFPRPM
LREFKGPNFGLPGIRKLVGVQDRPLIGTIVKPKVGLTSEKHAEVAYNSFAGGCDLVKDDE
NLTDQKFNGFDRRAELTLKFAEKAEVETGEKKMYLCNITAPTCKEMTRRLNVLKNLGASY
AMIDIVPVGWTALQTLREEAEDAGLALHAHRCMHSAYTRNPRHGISMVLVAKLCRLIGLD
QLHIGTVVGKMHGEKHEVLSLRDECVLDKVPADESQHVLTQDWGGLKPMFPVASGGLAPT
MIPDLYSIFGKDVIMQFGGGIHAHPMGTVAGATACRQALDASLEGVSMQDYAKDHKELEV
AIEKWLKK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagggactacatagacagggattatagcccaaaagacacagatctgatctgtgaa
ttccatatcgaaccgtcggcaggagtgaattttgaggaagttgccacccacatggcaggg
gaaagctctatagactcctggactgagatttccacattgagtcccgaacttgcagtaaaa
ttaaaacctcacattttttacctggacgaagaatcacagaccgtaagggtggcttactcg
gaagacctttttgagctgggttcggtcccccaggtgctgagtgctgttgcaggaaacatt
ttcagtatgaaaatcgttgacaacctcagactgcaggacatagccttccccaggccaatg
ctccgcgagttcaaaggtccgaacttcgggctgccggggatcaggaaacttgtgggggtg
caggaccggcctcttattgggactatcgttaagccaaaggtaggcttaacctctgagaaa
catgcggaagttgcttacaattcttttgccggaggttgcgaccttgttaaagatgatgag
aaccttaccgaccagaagttcaatggctttgacagaagggctgaactcaccctgaaattc
gcagaaaaagctgaagttgagaccggggagaagaagatgtacctctgcaacatcacagcc
ccgacctgtaaggaaatgacccggcgcttaaatgtcctcaaaaacctgggtgccagctat
gcaatgatcgatatcgtgccggtaggctggactgctcttcagactctgagggaagaggcc
gaagatgcgggtcttgcccttcatgcccaccgctgcatgcactcggcttatacccggaac
cctcgccatgggataagcatggttcttgttgccaagctctgcaggttgatagggcttgac
cagctccacataggtacggttgtcgggaaaatgcatggagaaaagcatgaagtcctgtct
ctaagggatgagtgcgtgcttgataaagtgcctgcggatgagagccagcatgtccttacc
caggactggggaggattaaagccaatgtttccggtagcgtctggagggcttgcccctaca
atgattcctgacctttactctatcttcggaaaagatgttattatgcagttcgggggtgga
atccatgcgcatccgatgggtacggtagccggagctactgcctgcaggcaagcccttgat
gcaagccttgaaggagtaagcatgcaggactatgcaaaggaccacaaagaacttgaagtt
gctatcgagaagtggcttaaaaaataa

DBGET integrated database retrieval system