KEGG   Methanosarcina sp. WH1: MSWH1_1503Help
Entry
MSWH1_1503        CDS       T03851                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
mef  Methanosarcina sp. WH1
Pathway
mef00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:mef00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MSWH1_1503
Enzymes [BR:mef01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     MSWH1_1503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AKB21774
UniProt: A0A0E3NQB8
LinkDB All DBs
Position
1834269..1835765
Genome map
AA seq 498 aa AA seqDB search
MFQGDFVVLEYKLIIGGESRDSSTGEAFDDINPATLENLGTVQVAGKEDVDRAVEAAEGG
FRVWSEVPAPRRAEVLFRAAHILQERKEDLALLMTEEMGKVLPETRGDVQEAIDITNYAA
GEGRRMFGETTTSELKDKFCMTVLRPIGVVGMITPWNFPIAIPSWKIMPALIAGNAIVFK
PASDTPLLAIKLVEILMEAGLPPGVVNIVFGPGGSVGKAIVQHPGIKAISFTGSFETGKW
IMEECAKTIKRVSLELGGKNPVIVMDDADLELALEGVLWGAFGTTGQRCTATSRLILHEK
IKDEFTTRLLAKTKLLRVGNGLLPETDIGPVINKAQLEKIERYVRIGKEEDATLLLGGNV
IDPGLPGYFFEPTIFTDVRPDMRIVQEEIFGPVLSIITVSGLDEAIEVANNTRYGLSSSI
YTESVGKAFRAIKKIESGITYVNAPTIGAEVHLPFGGVKGTGNGFREAGTEAIKEFTEIK
AVYIDYSGRLQKAQIDTK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
ttgtttcagggggattttgtggttcttgagtacaaattgattatagggggagagtcgaga
gactcatcaaccggagaagcttttgatgatatcaatccggctactcttgaaaaccttggc
acggtacaggtagccggaaaagaagacgtggacagggcagttgaggctgctgagggaggg
ttcagagtatggagcgaggttccggctcccaggagggctgaagtgctcttcagggcggct
cacattttacaggagagaaaggaagatcttgccttactcatgacagaagagatgggaaag
gtgctgcccgaaacaaggggagatgtacaggaagcaatagacattaccaattatgccgca
ggggaaggcaggcgaatgtttggggagacaacgacttccgaacttaaggacaagttctgc
atgaccgtgctcaggccgataggagttgtgggcatgataacgccctggaactttcctatt
gccattcccagctggaagatcatgccagcccttatagcaggaaatgcaattgttttcaag
cctgcaagtgacacgcctctgcttgcaattaaactcgtcgaaatcctgatggaagcaggc
ctgcctccgggagtggtaaacattgtgtttggacccggaggaagtgttggaaaagccata
gtccagcatcctggaataaaagcaatttcatttacaggaagctttgaaaccgggaaatgg
atcatggaagaatgcgcaaaaaccataaagagagtctctctggaactgggaggcaaaaac
ccggtaattgtcatggatgatgccgaccttgaacttgctcttgaaggcgtgctctggggg
gctttcgggacaacaggccagcgctgcacggctacgagcaggctgatcctgcacgagaaa
ataaaggacgagtttacaacaaggctgcttgcaaaaacaaaacttctcagggtaggaaac
gggcttctgcctgaaacggacatcgggcctgtaattaataaagcccagcttgagaaaata
gaaaggtacgtcaggataggaaaagaagaagatgcaactctcctgctcggaggaaatgtc
atagatcccgggcttcctggctatttttttgagccgactatctttacggatgtcaggccg
gatatgaggattgtacaggaagagatcttcgggcctgtgctcagcatcattacggtttca
ggtcttgatgaagcaattgaagttgctaataacaccagatatgggctttcttcgtcaatt
tatactgaaagtgtcggaaaagccttcagggcgattaaaaagatagaatcaggaatcaca
tatgtcaatgcccctacaataggtgccgaagttcaccttccctttggaggcgtaaaagga
accggaaacggtttcagggaagctgggacagaagcaatcaaagaatttacagagataaaa
gccgtgtacatagactacagcggcaggctgcagaaagcccagatagatacgaaatga

DBGET integrated database retrieval system