KEGG   Methanosarcina sp. WH1: MSWH1_1973Help
Entry
MSWH1_1973        CDS       T03851                                 

Definition
(GenBank) Tungsten-containing aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
mef  Methanosarcina sp. WH1
Pathway
mef00030  Pentose phosphate pathway
mef01100  Metabolic pathways
mef01120  Microbial metabolism in diverse environments
mef01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MSWH1_1973
Enzymes [BR:mef01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     MSWH1_1973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N Phosphonate-bd
Motif
Other DBs
NCBI-ProteinID: AKB22244
UniProt: A0A0E3NRX3
LinkDB All DBs
Position
2421754..2423577
Genome map
AA seq 607 aa AA seqDB search
MLGGYTGKILEVDLDSGELKDLPLDEEMAKMYLGGKGLGLKLVYDEFRPDMQPFDPDNLL
VFATGPATGEKVPTSGRYHIVCSKSPQTGTVGSGNSGGKWGPILKFAGYDAVVVRGISKE
PVYLSIVDGKAELVPAPELWGMTVHAVTDELTERSKNPKKTSVACIGPAGENLVPFSGIM
NDKYRTAGRTGLGAVMGSKKLKAVVVSGSQKVEPANPELLKERVVEAMKKIRENPVTAPD
GGLHTYGTAVLVNIINESGAYPTRNFQEAYFPDADEQSGETLVKKYLTGRGGCWGCPIVC
GRKSDVPEGPYSVRDTEGPEYETLFAFGSDCGITELDALIKANHLCDELGLDTISMGGTI
ACAMELVEKGKIPPEKMHGMNLRFGDPNSMIEAIWRTAYRAGIGADLALGSKKLAEKYEA
PELSMAVKGLELPAYDPRPIQGIGLNYATANRGGDHVYGYMISPEILGLPLKLDPYAVED
KPKWTIILQDLTSAINSSVVCLFTSFALGLPEYAGMLAAITGFDLDADKLLKLGERVTNL
ERLMNNMYGIDRNEDILPKRLTEEPIPSGPSKGQISHVPEMIDEYYRLRGWVDGKPTAEK
LKELGIA
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgttaggtggctataccggaaagatcctggaagttgaccttgacagcggcgagcttaaa
gacttaccgcttgacgaagaaatggcaaagatgtacctcggaggcaagggactcggccta
aaacttgtatacgatgagttcagaccggacatgcagccctttgaccctgataacctgctt
gtgtttgcaaccgggccggctaccggggaaaaagtcccgacaagcggacgttaccatatt
gtctgcagcaaatccccgcagacaggaaccgtagggagcgggaattccggagggaaatgg
ggtcccatcctgaaatttgcaggatatgacgcagttgtggtccggggaatttcaaaagaa
cctgtttaccttagcatcgtggacggaaaagccgaacttgtgccagccccggaactctgg
ggaatgacagtccatgctgtcacggacgaactgaccgaaaggagcaaaaaccccaaaaag
acatcggttgcctgcataggacctgcaggagaaaaccttgtccctttttccggcatcatg
aacgacaagtaccggaccgcaggcaggaccgggcttggggctgtgatggggagcaaaaag
ttaaaagcggtcgtagtttccgggagccagaaagtcgagcctgcaaaccccgagctcctg
aaagagcgggtcgtagaagccatgaaaaagataagggagaacccggtaacggctcccgac
ggagggcttcacacctacgggaccgcggtccttgtaaacatcatcaacgaaagcggagcc
tacccgacccggaactttcaggaagcctattttccggatgccgacgaacagagcggagaa
accctggtcaaaaaatacctgaccggccgcgggggctgctggggctgtccaatcgtttgc
gggaggaagtcagacgtgcctgaaggaccctacagtgtccgggatactgaaggcccggag
tatgagaccctctttgcctttggttccgactgtgggataacggagcttgatgcccttatt
aaggccaaccatctctgcgacgaactggggcttgacaccatctccatgggaggcaccatc
gcctgtgccatggaactcgtggagaaaggaaaaatcccgccagaaaaaatgcacggcatg
aacctacgatttggggacccaaactcgatgattgaagctatctggagaaccgcctatcgc
gcagggataggagctgaccttgctctcggctcgaaaaagcttgcagagaaatacgaggct
ccagaactctccatggctgtcaaaggcctggaactgcccgcctacgacccccgcccaatc
caggggataggcctgaattacgcaaccgcaaaccggggtggcgaccacgtctacggctac
atgatctcccccgaaatcctggggcttcccctgaaacttgacccctacgccgttgaggac
aagccgaaatggaccatcatccttcaggacctgacctcagccatcaattcatcggttgtc
tgcctctttacttcatttgccctgggccttcccgaatatgcagggatgttggcagcgatt
acgggctttgacctcgatgccgacaagcttctgaagctcggagagagagtcacaaacctc
gagaggctgatgaacaacatgtatgggattgaccggaatgaagacatccttccaaaacgt
ctcacggaagagccaatcccgtcaggaccctcgaaaggccagatatcccatgtcccggaa
atgatcgacgaatattacagactcaggggctgggttgacggaaagccgactgcagaaaag
ttgaaggaacttgggattgcctga

DBGET integrated database retrieval system