KEGG   Megasphaera sp. AJH120: DKB62_02470Help
Entry
DKB62_02470       CDS       T05599                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
meg  Megasphaera sp. AJH120
Pathway
meg00473  D-Alanine metabolism
meg00550  Peptidoglycan biosynthesis
meg01100  Metabolic pathways
meg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:meg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DKB62_02470
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DKB62_02470
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    DKB62_02470
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:meg01011]
    DKB62_02470
Enzymes [BR:meg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DKB62_02470
Peptidoglycan biosynthesis and degradation proteins [BR:meg01011]
 Precursor biosynthesis
  Amino acid ligase
   DKB62_02470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N GARS_A CPSase_L_D2 RimK ATP-grasp TTL ATP-grasp_4 ATPgrasp_ST ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: AXL22343
UniProt: A0A346B2K0
LinkDB All DBs
Position
complement(502395..503333)
Genome map
AA seq 312 aa AA seqDB search
METMKQKKIAVVVGGPSSEAEVSRNTGAAIAKALTTKGYAVETIELVPERLVETLKEKNI
DVVFNALHGRYGEDGVLQGLCEMMGLPYTGPGVMASAVGMSKVVSKCAFQGAGIPTAPFA
YYFSAQGLDYIADDIGRRFSLPVVIKSSAQGSTIGTVIVSDASDIRAALDEAFRYGPAII
AEAFLDGEEFTVAVMDDMAMPVIQIVPSTGRYDYYSKYTPGVTKHLCPAPISPELTKKMQ
DLALQVFHLCQCSGVARVDIMTNSQGEPFVLEINTVPGMTATSLVPDAAIAMGLSFEDLC
EKILLEASVGKF
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atagaaacgatgaaacagaaaaaaattgccgtcgtcgtcggcggcccgtcgtcggaagca
gaagtatcgcgcaataccggcgcggctattgccaaagcgttgacgacgaaaggctacgct
gtagagacgattgaactggtgccggagcggctggtagagacgcttaaggaaaaaaatatt
gacgtcgtattcaacgccctgcacggccggtacggcgaagacggcgtgctgcaggggctt
tgcgaaatgatgggccttccctatacgggtcccggcgtcatggccagcgccgtcggcatg
agtaaggtcgtgagcaaatgcgcttttcagggcgccggtattccgacggctcccttcgcc
tattatttctcggcccagggcttggactatatagctgacgatattgggcgtcgcttttcg
ctgcccgtggtcatcaagtcgtcggcccaggggtcgacgatcgggacggtcatcgtcagc
gacgcgtcggatattcgggcggctctggatgaagccttccgttacggtccggccatcatc
gccgaagcctttctcgacggagaagaatttaccgtcgccgtcatggacgacatggctatg
ccggtcattcaaatcgttcccagcacggggcggtatgattactattcgaaatatacgccc
ggcgtgacgaagcatctctgcccggcgccgatttcgccggaactgacgaagaaaatgcag
gatttagccctgcaggtcttccacctgtgccagtgcagcggcgtcgcccgcgtcgacatc
atgacgaacagccagggagaaccgttcgtcctggaaatcaacaccgtgcccggcatgacg
gcgacgagcctcgtgcctgacgcggctatcgcgatgggattgtcctttgaagacttgtgc
gaaaaaattttattggaagcctctgtcggcaagttttaa

DBGET integrated database retrieval system