KEGG   Megasphaera sp. AJH120: DKB62_07115Help
Entry
DKB62_07115       CDS       T05599                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
meg  Megasphaera sp. AJH120
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 3HCDH_N 2-Hacid_dh_C Pyr_redox_2 TrkA_N FAD_binding_3 NADH_4Fe-4S eRF1_3
Motif
Other DBs
NCBI-ProteinID: AXL21346
UniProt: A0A346AZQ3
LinkDB All DBs
Position
1519931..1520947
Genome map
AA seq 338 aa AA seqDB search
MKAVVVETPEKITVVERDIPEITSTQVLLKVKAAGICGSDVGIYHGKNAFATYPRVVGHE
FVGEVVKVGADVKNAAVGDHIAVDPVVSCGHCYACRTGRHNVCKTVNVLGVHRDGGYQEY
VAVEQNQLHQLPKDLPWEIAATVEPYSIGAQVAHQGRLTGDDTVLICGAGPIGLIILQVA
KMKGAKVAILDVVDSRLETAKEMGADMVINSKTKDPVEAMNEFTGGEGFNLIYEATGNVN
VLQMCIQKLPSPAGRVVVLGFSTVEFPIRQVDIMSKELEIIGTRLNNYRFPEVIEWFKEG
KVDPKSIVTNTFPFTEADKAFQYNDEHPENVLKIVLTF
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgtcgtagtagaaacaccggaaaagattaccgtcgtagaacgtgacattcct
gaaatcaccagcacccaggtcctgctcaaggtcaaagcagccggtatctgcggctccgac
gtaggcatttatcacggcaaaaacgccttcgccacctatccccgcgtcgtaggccacgaa
tttgtcggcgaagtcgtcaaagtcggcgcagacgtgaagaacgccgccgtcggcgaccac
atcgccgtcgaccccgtcgtgtcgtgcggccactgctatgcctgccgcacaggccgtcac
aacgtctgcaagaccgtcaacgtattgggcgtccaccgcgacggcggctatcaggaatac
gtcgccgtagaacagaaccagctccaccagctgccgaaggaccttccctgggaaatcgcc
gcgacggttgaaccctactccatcggcgcccaggtcgcccatcagggccgcctgaccggc
gacgacacggtcctcatctgcggcgcaggccccatcggcctgatcatccttcaggtcgcc
aagatgaagggcgctaaggtcgctatcctcgacgtcgtcgattcccgtctggaaacggcg
aaggaaatgggcgcagacatggtcatcaacagcaagaccaaagaccctgtcgaagcgatg
aacgaattcaccggcggcgaaggcttcaacctcatttacgaagcgacgggcaacgtcaac
gtattgcagatgtgcatccagaagctgcccagcccggcaggccgcgtcgtcgtattgggc
ttctcgacggtcgaattccccatccggcaggtcgacatcatgagcaaggaactggaaatc
atcggcacgcgcctcaacaactaccgtttccccgaagtcatcgaatggtttaaagaaggc
aaggtcgacccgaaatccatcgtcaccaacaccttccccttcaccgaagcggacaaggcc
ttccaatacaacgacgaacacccggaaaacgtgctgaaaatcgttcttacgttttaa

DBGET integrated database retrieval system