KEGG   Methylotenera versatilis: M301_0244Help
Entry
M301_0244         CDS       T01247                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
meh  Methylotenera versatilis
Brite
KEGG Orthology (KO) [BR:meh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    M301_0244
Enzymes [BR:meh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     M301_0244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored Thi4 FAD_binding_3 HI0933_like DAO AlaDh_PNT_C Glutaredoxin NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ADI28631
UniProt: D7DL20
LinkDB All DBs
Position
279199..280782
Genome map
AA seq 527 aa AA seqDB search
MALEAGIKTQLQTYLGMLREPIELVASLDDSAAAQEMRELLEEITSMSDKITLTNGDDAR
KPSFAVKRAAAHKDAGQSVGVRFAGIPMGHEFTSLVLALLHTGAHPMKLEAEKIAQIAAV
EGKFHFETYISLSCHNCPDVVQAMNMMAVINPNITHVMIDGALYQDEVKAREIMSVPTIY
LNGEVFGAGRMELDEILLKIDTGAAAREAKKIDAQAPYDVLVVGGGPAGASAAIYAARKG
IRTGIVAERFGGQVMDTLGIENFISVQETEGPKLVAAFEEHVKSYDVDIMNLQRAVSLSE
PGKDGNKNIDLIELKLESGGTLKSKVVILATGACWRELGVPGEKEYRGKGVAYCPHCDGP
LFKGKPVAVVGGGNSGVEAAIDLAGFVAHVTLLQFDTVLKADAVLQKKLHSLPNVTIITS
AQTTEVTGDGTKMNGLTYTDRITGESKHLALDAVFVQIGLLPNSDWLKGTVNLSKFGEVE
VNHHNATSLPGVFAAGDVTTTPYKQIIIAMGEGAKAALGAFDYLIRQ
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggcactagaagcaggtatcaaaactcaattacaaacatatttaggaatgttgcgcgag
cctatcgagcttgttgcttcattagatgacagcgcagctgcacaagagatgcgtgagtta
ctagaagaaattactagcatgtcagacaaaatcacgctgacaaatggcgatgatgcccgc
aagccatcatttgcggtgaaacgtgctgctgcacacaaagatgcgggccaatcagttggt
gtgcgctttgctggtattcctatgggtcatgaatttacctcactcgtattggcattacta
catactggcgctcaccccatgaaattagaggctgaaaaaatcgcgcaaattgcagcggtt
gaaggcaagtttcattttgaaacctatatttctttaagctgccacaattgcccagacgtt
gtgcaagcaatgaacatgatggcagtgattaaccccaacatcacccacgtgatgattgac
ggtgcgctttatcaagatgaagttaaagctagagaaattatgtctgtaccaaccatttat
ttaaatggtgaagtttttggcgcaggtcgtatggagctagacgaaattttattgaaaatc
gatactggcgcagcagcacgcgaggctaaaaaaatagatgcacaagccccttatgatgtt
ctagtggttggcggtggacctgcgggagcttctgctgctatttatgcagcacgtaaaggc
attagaacgggtatcgtggcagaacgttttggtggtcaggtgatggatacgctaggcatt
gaaaactttatttctgtgcaagaaaccgaagggccgaaattagttgccgcatttgaagag
cacgtgaaaagttacgatgtcgatattatgaacttacagcgtgctgtgagcctgtctgaa
ccgggtaaagatggcaataaaaatatcgatttgatcgaactaaaattagaaagcggcggt
accctaaaaagtaaagtggtgattctagcgacaggcgcttgttggcgcgagctgggcgtg
cctggtgaaaaggaatatcgcggtaaaggcgtggcctattgtccgcattgtgatggccct
ttgtttaaaggcaagcctgttgcagtggtgggtgggggtaactcaggtgttgaagcggcg
attgatttggcaggatttgtggcacatgtgactttattgcagtttgatacagtgctaaaa
gccgatgcagtgttgcagaaaaaactacattctttgcctaatgtcactattatcaccagc
gcgcaaacgactgaagtgactggcgatggcactaaaatgaatggcttaacttataccgac
cgcattactggtgaaagtaagcatttagcgcttgatgcggtatttgtgcaaattggtttg
ttgcccaacagcgattggttaaaaggcacggtcaatttaagcaagtttggtgaggttgaa
gtaaatcatcacaacgcgacttcattacctggcgtgtttgctgcgggcgatgtcacaact
acaccttataagcagattattattgcgatgggtgaaggtgcaaaagccgcgttgggtgcg
tttgattacttaattaggcagtaa

DBGET integrated database retrieval system