KEGG   Methylotenera versatilis: M301_1323Help
Entry
M301_1323         CDS       T01247                                 

Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
meh  Methylotenera versatilis
Pathway
meh00061  Fatty acid biosynthesis
meh00780  Biotin metabolism
meh01100  Metabolic pathways
meh01212  Fatty acid metabolism
Module
meh_M00083  Fatty acid biosynthesis, elongation
meh_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:meh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    M301_1323
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    M301_1323
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:meh01004]
    M301_1323
Enzymes [BR:meh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     M301_1323
Lipid biosynthesis proteins [BR:meh01004]
 Fatty acid synthase
  Component type
   M301_1323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-ProteinID: ADI29706
UniProt: D7DI21
LinkDB All DBs
Position
1477049..1477525
Genome map
AA seq 158 aa AA seqDB search
MTTNIESTSMDIHEILEHLPHRYPFVLIDRIVSLELGKEITALKNVTINEPFFPGHFPHH
PVMPGVLIVEAMAQAAAVLSFKTMGAKPSDDSVYYFAGIDSARFKKPVSPGDQVILNVKI
DRILKGIWKYSGVARVDGVVVAEAEMMCILKTIEKKEK
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgaccactaatatcgaatctaccagcatggacatccatgaaatccttgaacatctacct
catcgttatccttttgtactgatagatcgtattgtttcattggagttaggtaaagaaatc
actgcattaaagaacgtgactattaacgaacctttcttcccaggtcattttcctcatcac
cctgtcatgccaggagtgttaattgtggaggctatggcgcaagctgctgcagtactatct
tttaaaacgatgggtgcaaaaccaagtgacgactctgtttattattttgcgggtatagat
agtgcgcgctttaaaaaaccagtatctccaggtgaccaagtcattctaaatgttaagatt
gatcgtattttaaaaggtatatggaaatactctggtgtggcgcgtgttgacggtgtagta
gttgctgaagccgaaatgatgtgtattttaaaaacgatagaaaaaaaagaaaaataa

DBGET integrated database retrieval system