KEGG   Methylovorus glucosetrophus: Msip34_0135Help
Entry
Msip34_0135       CDS       T00943                                 

Definition
(GenBank) nicotinate-nucleotide/dimethylbenzimidazole phosphoribosyltransferase
  KO
K00768  nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase [EC:2.4.2.21]
Organism
mei  Methylovorus glucosetrophus
Pathway
mei00860  Porphyrin and chlorophyll metabolism
mei01100  Metabolic pathways
Module
mei_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:mei00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Msip34_0135
Enzymes [BR:mei01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.21  nicotinate-nucleotide---dimethylbenzimidazole phosphoribosyltransferase
     Msip34_0135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DBI_PRT
Motif
Other DBs
NCBI-ProteinID: ACT49384
UniProt: C6X8B4
LinkDB All DBs
Position
160026..161069
Genome map
AA seq 347 aa AA seqDB search
MQIPDIQTLDRGLSAALQHKIDQKTKPLGALGRLEGLALQLGLIQQRLDPVLRQPVMMVF
AADHGIVAAGVSPYPQAVTMQMVLNFLQGGAAINVFARQVGMDIRVVDAGVNHDFAPHPM
LLSHKVAMGTQNMLQAPAMSEAECEKAINIGRQLAHAEIAKGSNVLAFGEMGIGNTTAAA
ALMAALCQLPAQACVGRGTGLDDAGLQRKVDVVEQVLQHHASHLHSPLSALQHVGGLEIA
MMAGAMLGAAQKQAVILVDGFICTAAMLVASRIVPAVLDYAVFTHCSGEQGHRRLLQALQ
AEPLLDIGLRLGEGTGAALAYPLLQAAANFMNEMASFESAGVDGKSA
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattcctgatattcaaacgctggaccgcggcctttctgcggccctgcagcacaaa
attgaccagaaaaccaaaccactgggcgcccttggccgtctggaagggctcgccctgcag
ctggggctgatacagcagcgcctggatccggtgttgcgtcagccggtgatgatggtattt
gccgcggatcatggcattgtcgccgctggcgtcagcccttatccgcaggcggtgaccatg
cagatggtgctgaattttctgcagggtggggccgcaatcaatgtgtttgcccgccaggtg
ggcatggatatccgtgtggtggatgccggggtgaatcatgattttgcgccgcaccccatg
ctgctctcgcacaaggtggcgatgggcacgcagaacatgttgcaagcacctgcgatgtcg
gaagccgaatgcgaaaaagccatcaatattggcagacaactggcgcatgccgagattgcg
aaaggcagcaacgtgctggcgtttggcgaaatgggcataggcaataccacggcggcagcg
gccctgatggcggcgctgtgccagctgcctgcccaggcatgtgttggcaggggcacaggg
ctggacgatgccggcctgcagcgcaaagtggatgtggtggaacaggtgctgcaacatcac
gcttcgcacctgcacagtcctttatccgccttgcagcatgtgggtgggctggagatcgcc
atgatggcaggcgccatgctgggcgcggcacaaaagcaggccgtgatactggtggatggc
tttatctgtaccgccgccatgctggtggcaagtcgcatcgtcccggctgtgctggattac
gcggtgtttacccattgctctggggagcaagggcatcggcgtctgctacaggctctgcag
gcggagcctttgctcgacatcggtttgcggttgggtgaaggcaccggcgccgcgctggca
tatccactgttgcaggccgccgccaatttcatgaatgaaatggcctcgttcgaatccgcc
ggtgtggatggcaagagcgcttaa

DBGET integrated database retrieval system