KEGG   Methylovorus glucosetrophus: Msip34_0217Help
Entry
Msip34_0217       CDS       T00943                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mei  Methylovorus glucosetrophus
Brite
KEGG Orthology (KO) [BR:mei00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Msip34_0217
Enzymes [BR:mei01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Msip34_0217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 DAO HI0933_like FAD_oxidored FAD_binding_3 Thi4 NAD_binding_7 AlaDh_PNT_C K_oxygenase FMO-like NAD_binding_8 YhdX Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ACT49466
UniProt: C6X8J6
LinkDB All DBs
Position
242836..244380
Genome map
AA seq 514 aa AA seqDB search
MLDDTLKTQLQTYLGMLRQPIRLIASLDESEKAAEMRELLQDIAALSDKVSLDLAGSDAR
KPSFVIAREGETSGVRFAAIPLGHEFTSLVLALLWTGGHPPKVEADVIEQIKALDGDFRF
EVYMSLSCHNCPDVVQATALMAILNPKVQTTVIDGALYQDEVNGRNIMAVPTTYMNGEPF
GSGRMTVEEMLTKLDTGAEAREAAKLDQKAPYDVLIVGGGPAGASAAIYAARKGIRTGIV
AERFGGQVMDTLGIENFISVKETEGPKLVAALEEHVRSYDVDIINLQRAESITRGELVEV
KLAGGATLKSKAVIAATGARWRELNVPGEKEYRGKGVAYCPHCDGPLFKGKRVAVIGGGN
SGVEAAIDLAGFVGHVTLIEYDTKLRADAVLQNKLFSLPNVTVIINAQTTEVTGDSQKVN
GLVYKDRATSVDHHLELEGVFVQIGLLPNTDWLKGSDVELSKFGEIKVDAHGQTSMAGVF
AAGDVTTVPYKQIIIAMGEGSKAALGAFDYLIRQ
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacgatacactcaaaactcaacttcagacctatttgggcatgctgcgccagcct
atccggctgattgcttcactcgatgaaagtgaaaaagccgctgaaatgcgtgagctgctg
caagacattgccgcgctgtcagacaaggtcagcctggacctggcaggcagtgatgcccgc
aagccttcgttcgtgattgcacgtgaaggtgagaccagtggcgtgcgctttgctgccatt
ccgctgggccatgagtttacgtcgctggtgctggccttgttgtggaccggcggtcatcca
cccaaggtcgaagccgatgtgattgaacagatcaaggcgctggatggcgatttccgcttt
gaggtgtacatgagcctgtcctgccataactgcccggacgtggtgcaggcaacggcattg
atggccatcctcaaccccaaagtgcaaaccaccgtgattgatggtgccttgtatcaggat
gaagtgaatggtcgcaacatcatggccgtgcccaccacctatatgaacggtgagccattt
ggctcgggccgcatgacggttgaagaaatgctgaccaagctggataccggtgctgaggca
cgcgaggcggccaaactggaccagaaggcaccttatgatgtgctgatcgtaggcggtgga
cctgcgggtgcttcggcggccatctatgccgctcgcaagggcatacgtaccggtatcgtg
gccgagcggtttggcggccaggtgatggataccctgggcattgaaaacttcatctcggtg
aaggaaaccgaagggcccaagctggtggccgcactcgaagagcatgtgcgcagctacgat
gtcgatatcatcaatctgcaacgcgccgagtcgattacgcgcggcgaactggtcgaggtg
aagctggcaggtggcgcaacgctgaagagcaaggcagtgattgcggctaccggtgcccgg
tggcgcgagctgaatgtgcctggcgagaaggaataccgtggcaagggcgtggcgtattgc
ccacactgcgatggtcctttgttcaagggcaaacgcgtcgccgtgattggcggtggcaat
tcaggtgtagaggcagcgattgatctggccggttttgttggccatgtcaccctgattgaa
tacgacaccaagttgcgtgcggatgcggtgctgcagaacaagttgttcagcttgcccaat
gtgaccgtgatcattaacgcgcaaacgaccgaagtaaccggcgattcccaaaaggtcaat
ggtttggtgtacaaggaccgcgccacaagcgtggatcatcacctggaactggaaggtgtc
tttgtacaaatcggtctcttgccaaataccgactggctcaagggcagtgatgttgagctg
agcaaattcggtgagatcaaggtggatgcgcatgggcagacatcgatggcaggtgtattt
gcggcgggggatgtgacgaccgtgccttacaagcagatcatcattgccatgggtgaaggc
tccaaggctgcgctgggcgcatttgattacctgatacgccagtaa

DBGET integrated database retrieval system