KEGG   Methylovorus glucosetrophus: Msip34_0431Help
Entry
Msip34_0431       CDS       T00943                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
mei  Methylovorus glucosetrophus
Pathway
mei00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mei00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Msip34_0431
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mei01002]
    Msip34_0431
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mei01011]
    Msip34_0431
Enzymes [BR:mei01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Msip34_0431
   3.4.21  Serine endopeptidases
    3.4.21.-  
     Msip34_0431
Peptidases and inhibitors [BR:mei01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   Msip34_0431
Peptidoglycan biosynthesis and degradation proteins [BR:mei01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Msip34_0431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: ACT49679
UniProt: C6X959
LinkDB All DBs
Position
451767..453209
Genome map
AA seq 480 aa AA seqDB search
MRRLLLCCLLGLAVPAHAVLPLPVSQALQQAGLADDDVAVYAQRLDLPLPVIAHRADAAL
NPASTMKLLTTYAALDMLGPAYRWRTEIYRDGPLVDGVLQGNLILRGEGDPALMAEDFWR
LLGRLRQLGVRDITGDLIIDNSYFAPQAQDAAAFDGDGYRAYNVTASALVINLQASSLRL
AVSADSPARVEVSAEPALPGVVVQNRLQVTRDSCGDWRSRLQYKVQPKVEPQAANDPVRG
VSITLSGTFSADCGEKYLELSVLDGPQYTYQLFQSLWQSLGGSLHGEVRLQALPPQAVKL
TDQLSPLPLADVLRRLNKYSNNLMARQLLLTVAAQQGNLPATEEAGANAVRQWLVKKGYR
FPELMIENGAGLSRVERISPRHLGNILADAYAGPWMPELMSSLPVLGVDGTLLKRMQGQP
VQGRAHLKTGSLNGVSTLAGYVLDQHGQPWLLVFMANHPRAAATRSAQDALINWIYRHDE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
ttgcgccgcctgctgctttgttgcttgctgggtctggccgtgcctgcacacgccgtattg
cctctgcccgtgagccaggccttgcaacaggccgggctggcggatgatgatgtggcagtg
tatgcccagcggctggaccttcccctgccggtgattgcgcatcgtgccgatgccgcgctt
aatccggcatccaccatgaagctgctcacgacctatgccgcgctcgatatgctgggcccg
gcctaccgctggcgtaccgagatttatcgcgatggtccgctggtggatggcgtgctgcag
ggcaatctgattctgcgtggcgagggcgatccggcgttgatggcggaagatttctggcgt
ttgctgggccgtttgcggcagctgggagtgcgcgacattactggcgatctgatcatcgat
aacagctattttgcgccgcaggcgcaagatgccgcggcgtttgatggcgatggctaccgt
gcttacaacgtgaccgcctcggcgctggttatcaatctgcaagccagcagcctgaggctg
gcggtatccgccgatagtcctgccagagtagaagtcagcgccgagccggcattgccgggc
gtggtggtgcaaaaccgcctgcaggtcacgcgcgatagttgcggtgactggcgcagccgc
ctgcaatacaaggtgcaacccaaagtggagccgcaggcggcaaacgatccagtgcgtggt
gtgagcatcaccttgagcgggacgttttcggcagattgcggtgaaaagtatcttgagctc
agcgtgctggatggcccgcaatatacctatcagctgttccagagcctgtggcaatcgctc
ggtggctccttgcatggcgaggtgcgtttgcaggccttgccgccacaagcggtgaaactg
acggaccagctatcgccgctgccactagcggatgtgttgcgtcgcctgaacaaatacagc
aacaacctgatggcgcgccaattgctgctgacggtggctgcccagcaaggcaatctgcct
gccacggaagaggccggggcgaatgccgtgcgacaatggctggttaaaaaaggctaccgc
ttcccggagctgatgatagaaaacggcgccgggctgtcgcgtgttgagcgcatcagtccg
cgccatctggggaatattctggccgatgcctatgccggcccatggatgccggaactgatg
tcatcgttgcccgtgctgggcgtggatggcacgctgctcaagcgcatgcaaggccagccg
gtgcaagggcgggcgcatctcaaaaccggctcgctgaatggtgtgagcacgctggcgggt
tatgtgctggaccagcacggccagccctggctgctggtattcatggcgaatcacccacgc
gccgcggctacaagatcggcgcaggatgccctgattaactggatttaccggcatgatgag
taa

DBGET integrated database retrieval system