KEGG   Methylovorus glucosetrophus: Msip34_0463Help
Entry
Msip34_0463       CDS       T00943                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mei  Methylovorus glucosetrophus
Pathway
mei00473  D-Alanine metabolism
mei00550  Peptidoglycan biosynthesis
mei01100  Metabolic pathways
mei01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mei00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Msip34_0463
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Msip34_0463
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Msip34_0463
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mei01011]
    Msip34_0463
Enzymes [BR:mei01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Msip34_0463
Peptidoglycan biosynthesis and degradation proteins [BR:mei01011]
 Precursor biosynthesis
  Amino acid ligase
   Msip34_0463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATPgrasp_YheCD TTL
Motif
Other DBs
NCBI-ProteinID: ACT49711
UniProt: C6X991
LinkDB All DBs
Position
485007..485969
Genome map
AA seq 320 aa AA seqDB search
MRRVASKAHLQTHEPADVMMKNFGKVAVLMGGRSGEREVSLKSGGAVLAALLRQGVQAAA
FDPAERDLHELLAFDRVFISLHGRFGEDGTVQGALELMGIPYTGSGVLASSVGMDKWRTK
LLWRSAGIATPDFELLDASSDFAAVEQRLGLPMFVKPANEGSSIGISKVKQSGALKAAYE
LAAKSDPLVIAERFVGGGEYTVGILGDEALPIIRIVPANEFYDFEAKYLRDDTQYLCPCG
LPAEQEARIRAEALQAFRAIGGRGWGRVDFLMDESGRHYFLEVNTSPGMTDHSLVPMAAK
ANGISFDELVIRILELARVG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagggtagccagcaaggctcacctgcaaacacatgaaccagcggatgtgatgatg
aaaaattttggaaaagtggcggtattgatgggcgggcgctccggcgaacgcgaggtctcc
ctgaagagcggcggcgcggtgctggctgccctgttgcgtcagggcgtgcaggctgctgcc
tttgatcctgctgagcgcgatttgcatgaactgctggcgtttgaccgcgtgtttatctcg
ctgcatggccgctttggtgaagatggcacagtgcaaggcgcactggaattgatgggtatt
ccctacaccggcagcggtgtgctggcctccagcgtgggtatggataaatggcgtaccaaa
ctcttgtggcgctccgcagggattgcgacgccggactttgagctgctggatgccagcagc
gactttgcagccgtggagcagcgcctgggtctgccaatgtttgtcaagccagccaatgaa
ggctccagtatcggcatcagcaaggtcaagcagtccggcgcgctgaaagcggcatacgaa
cttgccgccaagtccgatccactggtgatcgccgagcgttttgtcggcggtggcgaatat
accgtgggcattctcggagatgaggccttgcccatcatccgtatcgtgccggccaacgaa
ttttatgactttgaagccaagtatctgcgcgatgacacgcagtacctgtgcccatgcggt
ttgcccgccgagcaggaagcccgcatccgcgctgaagcgctgcaggctttccgtgccatt
ggtggccgcggctggggtcgcgtggatttcctgatggatgaaagcggccgccattacttc
ctggaagtgaatacgtcgccgggcatgacagaccacagtctggtgccgatggccgccaaa
gccaatggcatcagctttgacgaattggtgatccgcatactggagttggcgcgtgtggga
taa

DBGET integrated database retrieval system