KEGG   Methylovorus glucosetrophus: Msip34_1176Help
Entry
Msip34_1176       CDS       T00943                                 

Definition
(GenBank) Aldehyde dehydrogenase (NAD(+))
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
mei  Methylovorus glucosetrophus
Pathway
mei00010  Glycolysis / Gluconeogenesis
mei00620  Pyruvate metabolism
mei01100  Metabolic pathways
mei01110  Biosynthesis of secondary metabolites
mei01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msip34_1176
   00620 Pyruvate metabolism
    Msip34_1176
Enzymes [BR:mei01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Msip34_1176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ACT50423
UniProt: C6XCZ8
LinkDB All DBs
Position
complement(1253272..1254792)
Genome map
AA seq 506 aa AA seqDB search
MSLESLKGLGVEIPYQAKYDNYIGGKWVAPVDGEYFDNISPVTGKVFCKVARSNDKDVNL
ALDAAHAAKEAWGKTSTTARSNILLKIADAMEANLEKIAIAETIDNGKPIRETMAADIPL
AIDHFRYFAGAVRAQEGGISEIDHDTIAYHFHEPLGVVGQIIPWNFPILMAAWKLAPALA
AGNCIVMKPAEQTPASILVVMEIIGHLLPPGVLNVVNGFGVEAGKALATSPRIAKIAFTG
STSVGRLIMQYASQNLIPVTLELGGKSPNIFFEDIMDADDAYFDKCLEGFTLFALNQGEV
CTCPSRALIQESIYEKFMERALKRVKAIKQGNPLDASTMIGAQASSEQVEIIMSYIKLGR
EEGAEVLTGGNVTKLAGELGEGYYIEPTVFKGHNKMRIFQEEIFGPVLSVTTFKDEAEAL
AIANDTMYGLGAGVWTRDGSRAFRMGRGIQAGRVWTNCYHLYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYNPNALGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgagtctggaaagcttgaagggcctgggtgttgagattccatatcaggccaaatatgac
aattacattggcggtaaatgggtagctcctgtagacggcgaatatttcgataacatcagc
ccggtgactggcaaagtgttctgcaaggtcgcccgctctaacgataaggacgtcaacctg
gcactggatgcggcacatgccgccaaggaagcctggggcaagacctcgaccacagcccgc
tccaatattctgcttaaaatcgccgacgcgatggaagccaaccttgaaaaaatcgcgatt
gccgaaaccatagacaacggcaagcccatccgcgaaaccatggctgcggacatcccgctc
gccattgatcacttccgttactttgctggcgcggtgcgcgctcaggaaggcggcatcagc
gaaatcgaccacgacaccattgcctatcacttccatgaaccactaggcgttgtcggccag
atcattccctggaacttccccattctgatggcggcatggaaactggcaccagccctggct
gctggcaactgtattgtcatgaagccggccgaacaaacgccagcttccattctggtggtc
atggaaatcatcggtcacctgttgccacccggcgtgctgaatgtggtcaatggttttggc
gtagaagcaggcaaggcgctggccaccagcccacgcatcgccaagatcgcctttaccggc
tccacttccgtgggtcgcctgatcatgcaatacgcatcgcaaaacctgattccagtgaca
ctggaactgggtggcaaatctccgaacatcttctttgaagacatcatggacgccgacgat
gcttacttcgataaatgtctggaaggtttcaccctgtttgcattgaatcagggcgaagtc
tgcacctgtccttcgcgtgccctgattcaggaatccatctacgagaaattcatggagcgc
gcactgaagcgcgtcaaggctatcaagcagggcaacccgctggatgcttcgaccatgatc
ggtgcgcaggcatcgagcgagcaggtcgagatcatcatgtcctacatcaagctgggccgt
gaagaaggcgcagaagtgctgaccggcggcaatgtcaccaagctggctggcgaactgggc
gaaggctattacatcgagcctaccgtgttcaagggccacaacaagatgcgcattttccag
gaagaaatcttcggccccgtgctgtcggtcactaccttcaaggatgaagccgaggccctg
gcgattgccaatgacaccatgtacggcctgggtgccggtgtgtggacgcgtgatggcagc
cgtgccttccgcatgggtcgtggcattcaggctggccgcgtgtggaccaactgctaccac
ctctaccctgcccatgccgccttcggtggttacaagcaatcgggtatcggtcgtgaaaac
cacaagatgatgctggatcactaccagcagaccaagaacctcctggtcagctacaaccct
aacgcattgggctttttctaa

DBGET integrated database retrieval system