KEGG   Methylovorus glucosetrophus: Msip34_2574Help
Entry
Msip34_2574       CDS       T00943                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mei  Methylovorus glucosetrophus
Pathway
mei03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mei00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Msip34_2574
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mei03400]
    Msip34_2574
Enzymes [BR:mei01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Msip34_2574
DNA repair and recombination proteins [BR:mei03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Msip34_2574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ACT51811
UniProt: C6XB41
LinkDB All DBs
Position
2707963..2710575
Genome map
AA seq 870 aa AA seqDB search
MGLNHYWQKRNFNITPEPSGQVAEAGDTLAFYIQRHHARRLHYDFRLELDGVLKSWAIPK
GPTLDPKEKRLAVHVEDHPLEYGHFEGQIPEHQYGAGKVILWDCGTWEPLEDPHVGYQKG
ALKFMLHGEKLSGKWALVRMGKTPAEGSSEKENWLLIKEKDDVAQSGEQANITENRPESI
RRLFSGDTHRPLKSSDKARRVSVASTLSSRQSAGAHHASPDLDGEVGKTQPMPTTMQPQL
ALLAKKAPVGEHWLTEVKFDGYRMLARCEDGEVKLYSRNGHDWTAKWKGIADALKQLPID
QAWLDGELVALQPNGKISFQALQDAMQANNAATLAYFVFDLMYLNGHDLRSQPLIKRKAL
LKTVLQRAADDSQAPSPLHFSDHIVGNAPEVFDHACLHDLEGIIAKRAESPYQPRRTEDW
LKIKCGLRQEFVIGGYTDPAGSRQGFGALLLGVYDAEGALHYAGRVGTGFTETTLAQVSK
QFSRLQRASSPFTGKLTGLQMRGVHWLTPKLVAEVRFAQWTDSQIVRHAAFVGLRQDKPA
REIVHETPANPPPPTEDAASSPEQSGQQRPQRSGSVREIAGVRLTHPGKILFAQAGLTKQ
DLAHYYEEIAPWILPQLQGRPLSLVRCPTGAGQQCFFQKHAAMTIPDNVRRIQVPVSGFS
DDYMVVDDLPALICLVQMGVLEIHTWGSREENLEQPDRIIFDLDPDEALPWTTVVESAQL
VHALLQALGLESFVKTTGGKGVHVVIPIVPEHSWQTIKAFSKSAAQYLEKQLPDRFTSNM
SKEKRTGKVFIDYLRNAPGATAIAAYSSRAKPSATVSVPISWEELNMGVRSDSFTIANLP
ERLARQKQDPWQDYERLRQHITTAMLEMFT
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atgggcctgaatcattactggcaaaagcgtaacttcaatatcaccccggaaccgtctggc
caggtcgccgaggctggcgacacgctggcgttttatatccagcgccatcatgcgcggcgc
ttgcactatgatttccgtctggagttggatggcgtgctgaaaagctgggcaatacccaaa
ggtcccaccctggaccccaaggaaaagcgactggcggtacatgtggaagatcatccgctg
gaatacgggcactttgaagggcagattcccgaacaccaatacggcgcgggcaaggtcatc
ttgtgggattgtggtacctgggagccattggaagatccccacgttggttaccagaaaggt
gcgctcaaattcatgctgcatggtgagaagctatccggcaaatgggcactggtgcggatg
gggaaaacgcctgccgagggttcttccgaaaaggaaaactggctgctgatcaaggaaaag
gatgacgtggcgcaaagcggtgagcaggccaacatcaccgaaaatcggccggagagcata
cgcagactgttcagtggcgatactcaccggccattgaaaagttcggacaaggcccgccgc
gtctcggtagcctcaacattgagtagccgccagtctgctggcgcgcaccacgcatcccct
gaccttgatggcgaagtcggaaaaacgcagcccatgcccaccaccatgcaacctcaactg
gcgctgctggcaaaaaaagcacccgtaggtgagcactggcttacagaagtaaaattcgac
ggctaccgcatgctggcgcgctgtgaagatggggaggtaaagctttactcgcgcaatggc
cacgactggacggcaaagtggaaaggcattgccgatgcgctcaaacaattgccaatcgat
caggcctggctggatggcgaactggtggcgttgcaacccaatggcaagatcagttttcag
gcgctgcaagacgccatgcaagccaataacgccgcgacactggcgtattttgtatttgac
ctcatgtacctcaacggtcacgacttgcgctcccagccgctgatcaagcgcaaggcgcta
ctgaagacagtgcttcaacgcgcagctgacgatagtcaggccccctctcccttacacttc
agcgaccatattgtcggcaatgctccggaagtattcgaccatgcctgtctgcatgatctt
gagggcatcattgccaagcgcgcggaatccccttatcagccgcgacgcacggaggactgg
ctgaaaataaaatgtggcttgcggcaggagtttgtcatcggcggctataccgatccagcg
ggtagtcgccagggatttggcgccctgctgctgggagtgtatgacgccgaaggtgccctg
cattatgccgggcgcgtgggaacaggctttaccgaaaccacgctagcccaggtgagcaag
cagttcagccgcctgcaacgcgcaagttcgccgtttaccggcaagctgaccggcttgcaa
atgcgaggcgtccattggctcacgcccaagctggtagccgaagtgcgtttcgcacagtgg
acagacagccagatcgtgcggcacgcggcttttgtcggcctgcgccaggacaaaccagcc
cgtgaaatcgtgcacgaaacgccggccaacccgccgccaccaaccgaagatgcggcatct
tccccagagcaatccggccagcaacgtccacagcgcagtggctccgtccgcgaaatcgcc
ggtgtgcggctgacccatccgggcaagattctgttcgcgcaggccggactgaccaagcag
gatctggcgcattactacgaagaaatcgccccatggatattgccgcagctgcaaggtcgc
cccttgtcgctggtgcgctgcccgacaggcgccggtcagcagtgttttttccagaaacat
gccgccatgaccatccccgacaatgtcaggcgcatacaggtgccggtaagcggattttca
gatgactacatggtggtggatgatctgccagcgcttatttgcctggtgcaaatgggcgtg
ctggagatacacacctggggctcgcgcgaggagaatctggaacaaccggatcgcattatt
ttcgaccttgacccggatgaagccctcccatggacgaccgtggtggagagcgcacaactg
gtgcatgcattgctgcaggcgctaggcctggagagcttcgtcaaaaccaccggtggtaaa
ggcgtacacgtcgtgatcccgattgtgcccgaacacagctggcagacaatcaaggcattc
agcaaatcggcagcgcaatatcttgaaaagcaattacccgatcgctttacttccaatatg
tccaaggaaaagcgcaccggcaaagtgttcatcgactatctgcgcaatgcgcctggggcg
acagcgattgccgcttactccagccgggccaaaccaagcgctaccgtgtcggtgcctatt
tcatgggaggagctgaacatgggggtacgctcggactccttcaccatcgccaatcttcca
gagcgccttgcgcgtcagaaacaggatccctggcaggattatgaacgcctgcggcaacac
atcactacggccatgctggagatgtttacctga

DBGET integrated database retrieval system