KEGG   Methylophaga nitratireducenticrescens: Q7A_1139Help
Entry
Q7A_1139          CDS       T02055                                 

Gene name
fabZ
Definition
(GenBank) beta-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
mej00061  Fatty acid biosynthesis
mej00780  Biotin metabolism
mej01100  Metabolic pathways
mej01212  Fatty acid metabolism
Module
mej_M00083  Fatty acid biosynthesis, elongation
mej_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:mej00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Q7A_1139 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Q7A_1139 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mej01004]
    Q7A_1139 (fabZ)
Enzymes [BR:mej01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     Q7A_1139 (fabZ)
Lipid biosynthesis proteins [BR:mej01004]
 Fatty acid synthase
  Component type
   Q7A_1139 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT DUF2808
Motif
Other DBs
NCBI-ProteinID: AFI83977
UniProt: I1XHV8
LinkDB All DBs
Position
1153935..1154384
Genome map
AA seq 149 aa AA seqDB search
MNTIDIHEIQRLLPHRYPFLLIDRVIEFIPGEHLVGIKNVSFNEPHFTGHFPQRVIMPGV
LILEALAQATGLLAFKTADQIRSDDALYYLAGIDNARFKKPVEPGDQLRLEVKLIKNKRN
LWKFYAQATVDGEVVVSADIMCVNQEMPS
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaccattgacatacacgaaattcaacgcttactgccacatcgatacccttttctg
ttgattgacagggtgattgaatttataccgggtgaacatctggttggtatcaaaaatgtc
agcttcaatgaaccgcactttaccgggcattttccacaacgtgtgattatgcctggcgtg
ttaattctggaagcattggctcaggctacaggattactggcatttaaaacagcagatcaa
attcgttctgatgatgcgttgtattatcttgctggtattgataatgcgcgttttaaaaaa
cctgtcgaaccgggcgatcagttgcgtttagaagtaaagctgattaaaaataaacgtaat
ttgtggaaattttatgctcaggcaactgttgacggcgaggtcgttgtcagtgctgatatt
atgtgtgttaaccaagaaatgccttcgtga

DBGET integrated database retrieval system