KEGG   Methylophaga nitratireducenticrescens: Q7A_121Help
Entry
Q7A_121           CDS       T02055                                 

Definition
(GenBank) phosphate regulon sensor histidine kinase PhoR
  KO
K07636  two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC:2.7.13.3]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
mej02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mej00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Q7A_121
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mej01001]
    Q7A_121
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mej02022]
    Q7A_121
Enzymes [BR:mej01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Q7A_121
Protein kinases [BR:mej01001]
 Histidine kinases
  OmpR family
   Q7A_121
Two-component system [BR:mej02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   Q7A_121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoR HATPase_c HisKA HATPase_c_2 DUF4446 HATPase_c_5 PAS PAS_8 ApoLp-III HATPase_c_3 FixQ
Motif
Other DBs
NCBI-ProteinID: AFI82980
UniProt: I1XF11
LinkDB All DBs
Position
complement(121072..122361)
Genome map
AA seq 429 aa AA seqDB search
MQWDYWRLLTVLSLAGFVGLVVGHMMAFLFVAALIYIFWMQSKWNQLQAWLDKPKKNSSP
QAEGVIDDVCRQIEQMRAQNSSRKKKLTGYLKRFQSATAALPDAVVVMGEFGQVSWANTS
AMTLLGINWPHDNGVRVNNLVRDPAFQKLLELENNAEDVIIAASPMNDRIQLEFKVVRYA
SKDRLLIARDITQTQKLQRMRRDFVANVSHELRTPLTVLRGYLETLTTESDQELWQQALP
IMQQQSQRMHLMIKDLLALSQLETGEKPLQHRPTDICKLLHSVVEDAKRLEHFHQHQISL
HCLSEKWLMADADELRSAISNLVFNAVKYTPAETLIDVRWHIEGIFAVIEVKDTGEGIAQ
HHLDRLTERFYRVDSGRARETGGTGLGLAIVKHVLQRHKAELVIQSAIGEGSSFKCCFPV
KSVMDKIDI
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgcaatgggattattggcgtttactgacggtactcagtctggccggttttgttggattg
gttgtcggccatatgatggctttcctgtttgtcgctgcgcttatttacattttttggatg
cagagcaaatggaaccagttgcaagcctggctggataagccgaagaaaaatagctctccg
caagccgagggggttattgatgatgtgtgccggcagatcgaacagatgcgcgcacaaaac
agcagccgtaaaaaaaagctcaccggttatttaaaacgtttccaatcggcaacggctgct
ttgcccgatgcggtggtcgtcatgggcgaatttgggcaggtcagctgggccaatacctca
gctatgaccttgttaggaatcaattggcctcatgacaacggcgtcagggtcaacaatctg
gttcgtgacccggcattccagaaacttcttgagctggagaataatgccgaggatgtcatc
atcgccgcttcaccgatgaatgatcgtatccagcttgaattcaaagtggtgcggtacgcc
agtaaagatcggttattgatcgccagagatattacccagacccagaagttgcagcgtatg
cggcgggatttcgtagccaatgtgtcgcatgaattgcgtacaccgttgacggttttgcgg
gggtatctggaaaccttgaccacggaaagtgatcaggaactctggcaacaggctttaccg
atcatgcagcaacaaagccagcgaatgcatctgatgatcaaggatctgctggcattatcc
caacttgaaaccggtgaaaagccgttgcaacaccgtccaacggatatctgtaaattgctg
catagtgtggtggaagatgccaaacgactggaacattttcatcaacatcagatcagcctg
cactgcctgagcgaaaaatggctgatggcagatgctgatgaactacgcagtgcaatctcc
aacctggtctttaatgccgtcaaatatactccggcagaaaccttgatcgatgtcagatgg
catattgagggcatttttgccgtcattgaggtgaaagataccggtgaaggtatcgcccaa
catcatctggatcgcctgacagaacgtttttatcgtgttgatagtggtcgtgccagggaa
accggtggaacaggactggggctggctattgtcaagcatgtgttgcaacgacacaaagca
gaattggtgattcaaagtgctatcggtgaaggatcaagttttaaatgctgttttcccgtc
aaaagcgtgatggataaaatcgacatttag

DBGET integrated database retrieval system