KEGG   Methylophaga nitratireducenticrescens: Q7A_1504Help
Entry
Q7A_1504          CDS       T02055                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mej  Methylophaga nitratireducenticrescens
Brite
KEGG Orthology (KO) [BR:mej00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Q7A_1504
Enzymes [BR:mej01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Q7A_1504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 HI0933_like GIDA FAD_binding_2 DAO FAD_binding_3 FAD_oxidored K_oxygenase Thi4 NAD_binding_8 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AFI84330
UniProt: I1XIW1
LinkDB All DBs
Position
1511680..1513257
Genome map
AA seq 525 aa AA seqDB search
MLDANIAAQLKTYLQNLQRPIEIIASLDDGKKSLEMRELLVEIADMSDKVSFSDADNDAR
KPSFRIKQPEGQEQIRFAGIPMGHEFTSLVLALLHTGGHPMKTEPEVIEQIKQLDGEFVF
ETYISLSCQNCPEVVQALNLMAVLNPNIHHTMIDGALYPEEVEARQIMAVPTVYLNGEVF
GQGRMSLTEIIGKLDTGAIKREAEKISQRAPYDVLIIGGGPAGASASIYASRKGIRTGIV
AERFGGQVMDTLAIENFISVKETEGPKLVAALEEHVKEYEVDVMKLQRANKLSQKGKMLE
VELESGATLTSKSIIIATGARWRELGVQGEAEYRGHGVAYCPHCDGPLFKGKHVAVIGGG
NSGVEAAIDLAGIVGYVTLLEYADQLKADAVLQKKLHSLNNVTVIIGAQTTEITGDGKKV
NGLNYKDRATEESHHVELAGVFVQIGLLPNTDWLKDTLTLSKYGEIEIDSHGATSMPGVF
AAGDVTTIPYKQIIMAMGEGARAALGAFDYLIRNEFDDKDKDKAA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgctaatattgctgcacaattaaaaacttatctgcaaaatctgcaacgtccg
attgagatcattgcgtcactggatgatggcaaaaaatctctggaaatgcgtgagttgcta
gtggaaattgctgatatgtcagataaagtcagcttttctgatgccgataacgatgcacgt
aaaccttcattccgtattaaacagcctgaggggcaggagcaaatccgttttgccggaatc
ccaatgggccatgagtttacctccctggttttggcattactgcacacaggcgggcatcca
atgaagaccgagcctgaagtgattgaacaaatcaaacagcttgatggcgagtttgtgttc
gaaacctatatttccctgtcatgtcagaactgccctgaagtggtacaggcgcttaatctg
atggcggtgttgaatccaaatattcatcacaccatgatcgatggtgcgttgtatccggaa
gaagtcgaggcacgtcagattatggccgtgccgactgtttacttgaatggtgaggtgttc
ggtcagggacgtatgagcctgacagaaattatcggcaaactggacaccggtgccattaaa
cgtgaagcagaaaaaatcagtcagcgtgccccctatgatgtattgattattggtggcgga
ccggctggtgcttctgcatcaatttatgcatcacgcaaaggtattcgtaccggtattgtg
gctgaacgttttggtgggcaggtgatggataccctggcgattgaaaactttatttcagtc
aaagagaccgaagggccaaaactggttgctgcacttgaagaacacgtcaaagaatatgaa
gtagacgtgatgaagttacagcgcgccaacaaattaagtcagaaaggcaaaatgcttgaa
gtggaactggaaagcggtgccacactgaccagtaagtcaatcatcattgcgaccggtgcc
cgctggcgtgagctgggcgtgcagggtgaagcagaataccgtggtcacggtgttgcctat
tgccctcattgtgatggccctttatttaaaggtaaacatgttgcggtaattggcggcggc
aattccggtgtcgaagccgcaattgatctggctggtattgtgggatatgtgaccttgctg
gaatatgccgatcaactgaaagccgatgcggtattgcagaaaaaactgcacagtctgaac
aatgtaacggtaatcattggtgcgcaaaccactgaaattactggcgatggcaagaaagtg
aacggtctgaattataaagatcgtgcgactgaggaatcgcatcatgttgagctggctggt
gtgtttgtgcagattggtttgttacccaacaccgactggttaaaagacacgctcacattg
agcaaatatggtgagattgaaattgattctcacggggcaacctcaatgccgggtgtcttt
gctgccggtgatgtgacaaccattccatacaagcagatcattatggcaatgggcgaaggt
gccagagcggccctgggcgcttttgattatcttatccgtaatgaatttgatgataaggat
aaagataaagcagcttaa

DBGET integrated database retrieval system