KEGG   Methylophaga nitratireducenticrescens: Q7A_1869Help
Entry
Q7A_1869          CDS       T02055                                 

Definition
(GenBank) ATP-binding protein
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
mej02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mej00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Q7A_1869
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mej02000]
    Q7A_1869
Transporters [BR:mej02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    Q7A_1869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_21 AAA_29 AAA_16 Rad17 RsgA_GTPase T2SSE COQ7 SbcCD_C AAA_22 AAA_23
Motif
Other DBs
NCBI-ProteinID: AFI84687
UniProt: I1XJW8
LinkDB All DBs
Position
1902331..1904022
Genome map
AA seq 563 aa AA seqDB search
MFSHSQKNFAPLKFWLIKVLQNQKKRLIISLLLALLTAISAMGLLALSGWLITATAITGL
AITAGTAVLLDIYRPGGGIRFFALSRTVGRYFERLHSHDMVLRVIAGFRLTLFTGLMDLP
VQQLRNTEDSEWLSRLTADLDNLDSLLLKLLLPPIVVISSVLLLVVFISFFWLTLGVTFG
VITLLLGSIYFSFFTRKTSQISSDYARQINQARSQTIEHLQGQLELQAAHLQQADQARLV
SSLSEIGKSQLKLNRHIANAQLIVNICHGLLVIAVAIAALFAYQNQLVSGPVAVMLFLAV
FGLGELLLNLPGQLGQWGRTRYAAERLQPLAEHAASEKSTLAELERLSMMLADHPKVISS
IDTAFAFELNPSECLLISGRSGSGKSTLANILAGLEIPDSFITPYQLLINGIPLRIDQTQ
AWHKQIGYLTQQNSIIAATLYSNLTLGLNDIDEHKLWQALTLVELDDWAKQLPAGLHSWL
GDTGSQLSGGQARRICLARLLLKETKLILLDEPFNGIDTEMAERIWQRLYPQWQDKMLIV
LMHDRPAFFPAIDNQQMFEINLD
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgttcagccattctcaaaagaattttgcccccctgaagttctggctaatcaaagttctg
caaaatcagaaaaaacgattaatcatctctttactgctggccttattaacggctatttcc
gccatggggttattagcgttgtctggctggttgattacagctactgcaatcaccgggctg
gcgattaccgctggcactgccgtgttattggatatctaccgaccgggtggtggcattcgg
ttttttgcgttaagtcggacagtgggacggtattttgaacggctgcatagtcacgatatg
gtgttaagagtgattgccggatttcgactaaccctgtttaccggcctgatggacttgccg
gttcagcaactgcgaaacacagaggatagtgaatggctgagccggttaaccgcagatctg
gataatctcgacagcctgttattaaagttacttttacctccaattgttgtgatatccagc
gtgcttttgcttgtagtttttatcagttttttctggttaacgctgggggttacattcgga
gttatcacgctgctgttgggaagtatttatttcagcttttttactcggaaaacatcgcag
ataagcagcgattatgcccggcagattaaccaggctcgctcacaaaccatagagcatctt
cagggccagctggaactccaggcagcacatctgcaacaagcggatcaagcaagattggtc
agttcgctgagtgagattggcaagtcgcagctaaaattgaatcgacatatcgccaacgca
cagttaatagtgaatatttgtcatggattgttggtcatcgctgtggcaattgcagcgtta
tttgcctaccagaatcagcttgtcagtggaccggttgccgtcatgttgtttctggccgtg
tttggattgggtgagttacttttaaacctgccaggccagctagggcagtggggcaggaca
cgctatgcagctgaacggttgcaacccctggcagagcatgcagcttcagagaaatcgacg
ctggcagaacttgagcggctgtcgatgatgctggcagatcaccctaaggttatcagcagc
atagataccgcttttgcttttgaacttaacccatctgaatgtctgttaataagtggccga
tccggaagcggcaaatcgacattagccaatatactggcaggactggagataccggactca
tttataacgccttatcagttgttgataaacggcattccattgcgaatcgatcaaacacaa
gcttggcacaagcagattggctatctgactcagcaaaacagcatcatcgccgcgacgtta
tatagcaatctgacactggggctgaatgacatcgacgaacataagctttggcaggcactg
accttggtcgagctggatgattgggccaaacaactaccagccgggttacacagctggctg
ggtgataccggcagtcaactttccggagggcaggcccgaaggatctgtctggcaagactc
ttattaaaagaaacaaaactgatcttgcttgacgagccatttaacggcattgataccgaa
atggcagaacgtatctggcagcgtttgtatccgcaatggcaggacaaaatgcttatcgtg
ctgatgcatgatcggccagcgtttttcccagcaattgataatcagcaaatgtttgaaatc
aatctggattaa

DBGET integrated database retrieval system