KEGG   Methylophaga nitratireducenticrescens: Q7A_2908Help
Entry
Q7A_2908          CDS       T02055                                 

Definition
(GenBank) superoxide dismutase [Cu-Zn] SodC2
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
mej  Methylophaga nitratireducenticrescens
Brite
Enzymes [BR:mej01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Q7A_2908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AFI85685
UniProt: I1XMR6
LinkDB All DBs
Position
complement(2714290..2714802)
Genome map
AA seq 170 aa AA seqDB search
MKLLTCIMIALTSSVAFADTQIELYEVDKQGTGKSLGSVAVHQSAFGLVFTPDLKSLTPG
LHGFHVHQNPSCDAAEKDGEMVPALAAGGHYDPYNTGKHDTPWGSGHAGDLPPLYVADDG
TATHPVLAPRLTLKDLQGRSLMIHAGGDNHSDHPKPLGGGGARVACGVTD
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaaactattgacgtgcataatgattgcgctgacatcttcggtagcatttgctgataca
cagatcgagctttatgaagtggataaacagggaaccggcaaaagtctgggaagcgtagca
gtacatcaatcagcatttggtctggtttttaccccagatttgaaatcgctaacacccggt
ttgcatggctttcatgtgcatcagaatccaagctgtgatgctgctgaaaaagacggtgaa
atggtgcctgcattggccgctggcggccattatgatccctacaataccggtaagcacgac
accccctggggcagtggacatgctggtgacttgccaccattgtatgtagccgatgatgga
acagcaactcatccagtgcttgcaccacgcttgacgcttaaagatttacaagggcgttcg
ttaatgattcatgctggtggtgacaatcactctgatcaccctaaacccttaggtggcggt
ggtgcccgagtcgcctgcggtgtaaccgattaa

DBGET integrated database retrieval system