KEGG   Methylophaga nitratireducenticrescens: Q7A_450Help
Entry
Q7A_450           CDS       T02055                                 

Definition
(GenBank) carbonic anhydrase
  KO
K01673  carbonic anhydrase [EC:4.2.1.1]
Organism
mej  Methylophaga nitratireducenticrescens
Pathway
mej00910  Nitrogen metabolism
mej01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mej00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Q7A_450
Enzymes [BR:mej01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     Q7A_450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro_CA
Motif
Other DBs
NCBI-ProteinID: AFI83301
UniProt: I1XFY2
LinkDB All DBs
Position
458999..459685
Genome map
AA seq 228 aa AA seqDB search
MRDVGKFLQGFRRFQQHYLGEQHALFDQLLTEGQRPRALMIACCDSRCDPALLTDCEPGD
MFVVRNVANLVPPYDQARLFAATSSAIAFAVSSLEVEHVIIMGHAHCGGIQALMTHKTPE
NDESKLISQWIGIAESAREQVLQQLPNKTPEVQAHACEQASILISLENLRSYPWISKRVE
LGKLALHGWYFDMDKGELLQYQQESGKFEVLVANGDKRPISPFSSSKR
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgcgagatgttggaaagtttcttcagggatttagacggttccagcaacattatctggga
gagcagcacgcactgtttgatcaactgcttacagaaggtcaacgtccgcgagctctgatg
attgcttgttgtgattctcgctgtgatccggcattgcttacggattgtgagcctggtgat
atgtttgtggtacggaatgtcgccaatctggtgcctccctatgatcaggccagattgttt
gccgctacaagttctgccattgcttttgccgttagcagtcttgaagtagagcatgtcatc
attatgggacatgcgcattgtggtggtattcaggcattaatgacacacaaaacgcctgag
aatgatgaatcgaaattgatttcacagtggattggaattgccgaatcagctcgtgagcag
gtgttgcaacaattgcccaataaaacgcctgaggttcaggcgcatgcctgcgagcaggcc
tcaatactgatctcgctggaaaatctccggtcgtacccatggattagcaaacgtgtagag
ctgggcaaactggctttacacggttggtatttcgatatggataaaggtgaattacttcag
tatcagcaagagagtggcaagtttgaagtgcttgtggcaaatggcgacaaaagaccgata
agccctttttctagctccaaaagatag

DBGET integrated database retrieval system