KEGG   Methanosarcina sp. Kolksee: MSKOL_0041Help
Entry
MSKOL_0041        CDS       T03821                                 

Definition
(GenBank) RNA ligase, family
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
mek  Methanosarcina sp. Kolksee
Brite
KEGG Orthology (KO) [BR:mek00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MSKOL_0041
Enzymes [BR:mek01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MSKOL_0041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lig_C RNA_ligase DNA_ligase_A_M DUF587
Motif
Other DBs
NCBI-ProteinID: AKB45818
UniProt: A0A0E3Q9W7
LinkDB All DBs
Position
complement(8943..10115)
Genome map
AA seq 390 aa AA seqDB search
MSREGNEEIDPQFIVKLASFLGFDKERVQHLFEKNYLAQNWGKYEYLFRFDKEISHIERG
TVLYEKDDSFEIIMGFPKIRRAMVLDTTIKKHFSGLEKVAVEEKMNGYNVRIAIAKDEIL
AITRSGYICPYTTQKAKEKLNLKFFDDFPELVLYGEMIGPDNPYVPKDIYGIDSVEFYIF
DIREKNSGKPLPISRKQEILEKYGFFQVKFFKEIPLESAAEEIGKIIRELGEKEHEGVVI
KDPEMVLSPLKYTSSQSNCSDLRHAFKFYNETGRDYMLSRIVREGFQTVEWNEDKAEFEK
RCMQLGKSILGPLSESILSVKNGQRLYEEAKIRVRDLKTAAEFEDYLKRLGIDAIFEEPQ
LVGEEYLVIIKKINKSTNDKTQAMWQGETW
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagtagagaggggaacgaggaaatagatcctcaatttatagttaagcttgccagtttc
ctgggattcgataaagaaagggttcagcacctttttgagaaaaactatcttgcccagaat
tggggaaaatatgaatatctgttccgtttcgataaggagatctcccatatagagagggga
actgtgctttatgagaaagacgattctttcgaaatcataatgggtttcccgaaaatccgg
agagcaatggtactggacaccacgattaaaaagcacttcagcggccttgaaaaagtggct
gtggaagaaaagatgaatgggtataatgtccgcatagcgattgcaaaagacgaaattctt
gcaattacccgaagcggatatatctgtccctatacgactcaaaaagcaaaagagaaattg
aacctgaagttttttgacgatttccctgaacttgtactttatggagagatgataggtccg
gacaatccttatgtccctaaagatatctatggcatcgattcagtagagttttatattttt
gatatccgggagaaaaatagcggtaagcctctcccaataagccggaaacaggaaattttg
gaaaagtacggctttttccaggtaaagtttttcaaagaaattcctctggaaagtgctgct
gaagaaattggaaaaatcatccgggaactcggagaaaaagaacatgaaggcgtcgtaata
aaagacccggaaatggttctttctccgttaaaatatacctcttcccagagtaattgctcg
gatctcagacatgcctttaagttttacaatgagaccggcagagactatatgctttcccga
attgtcagagaaggttttcaaacagttgaatggaacgaagataaggccgagtttgaaaaa
cgctgcatgcagctagggaagagtatacttggccctctcagtgaatccattctgagtgta
aaaaacggtcagcggttatatgaagaagcaaagatccgggtaagggatctaaaaactgca
gccgagttcgaagattatcttaaaagactcgggatagatgcaatttttgaagagcctcag
ttagtaggagaagagtatctggtaattataaaaaagattaacaaaagcaccaacgataaa
actcaagcaatgtggcagggtgaaacctggtga

DBGET integrated database retrieval system