KEGG   Methanosarcina sp. Kolksee: MSKOL_0967Help
Entry
MSKOL_0967        CDS       T03821                                 

Definition
(GenBank) CO dehydrogenase/acetyl-CoA synthase subunit alpha, CO dehydrogenase subcomplex
  KO
K00192  anaerobic carbon-monoxide dehydrogenase, CODH/ACS complex subunit alpha [EC:1.2.7.4]
Organism
mek  Methanosarcina sp. Kolksee
Pathway
mek00680  Methane metabolism
mek01100  Metabolic pathways
mek01120  Microbial metabolism in diverse environments
mek01200  Carbon metabolism
Module
mek_M00422  Acetyl-CoA pathway, CO2 => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mek00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MSKOL_0967
Enzymes [BR:mek01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.4  anaerobic carbon-monoxide dehydrogenase
     MSKOL_0967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prismane Fer4_21 Fer4_7 Fer4_8 Fer4_9 Fer4_17 Fer4_6 Fer4 Fer4_2 Fer4_22
Motif
Other DBs
NCBI-ProteinID: AKB46744
UniProt: A0A0E3QBN1
LinkDB All DBs
Position
complement(1207877..1210303)
Genome map
AA seq 808 aa AA seqDB search
MSKLTTGSFSIEDLESVQITINNIVGAAKEVAKEVKGAEEELGPMGPTPFPTIATLRDWS
FTLFDRYEPVYTPMCDQCCYCTFGPCNLEGNKRGACGIDMKGQAAREFFLRCLTGCACHS
AHGRHLLNHIVDLFGGDMPINMGASNVIAPNIQLVTGRQPKTLGELKPIMEYVEEEVGQL
LATVHAGQEAAAIDYDNKAMFAGVLDHVGMEVSDIAQVTALGFPKSDPEAPLVEVGMGTI
DASKPVIIAIGHNVAGVTYIMDYMEDNGLTDKMEIGGLCCTAFDMTRYKREDRKAPYAKI
VGTISKELKIVRSGIPDVIVLDEQCVRADLVMEGQKLKIPIIASNEKIMYGLDDRTNDDV
DAIVEDLVTGKIPGCVMLDYEKLGELVPKVALKMAPIREAEGLSAIPTDDEMKALVSKCV
ECGECALACPEELGIPAAIAVAKGEDYSALEELHDLCVGCRRCEQVCNKEIPILSLIEKA
AQKAIAEEKGFVRAGRGQVSDPEIRAEGLNLVMGTTPGVIAIIGCANYPAGSKDVYSIAE
EFLNRNYIVAVSGCSAMDIGMYKDADGKTLYERYPGRFEKGNILNTGSCVSNAHISGTVH
KVAAIFASRNLSGNLAEIADYAINRVGAVGLAWGAYSQKAAAIGTGCNMYGIPAVLGPHS
GKYRRALIAKTYDDSKWELYDSRNGSKMAIPPSPEFLITTAETWQEACVMLAKNCIRVSD
NNMGRSIKLTHWLEISEKYLGVLPDDWWKFVRNEADLPLAKREMLLKMLESERGWEIDWK
KKKIISGPAIKFDVSSQPTNLKRLCKEA
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaactaactaccgggagtttttctatagaagatctggaatccgttcagatcact
atcaataatattgtaggggcagcaaaggaggttgccaaagaagtaaaaggagcagaagaa
gaacttggcccgatgggtccgacccccttccccacaatcgccacattaagggactggagt
tttacactgtttgaccgctacgagccggtctacacccccatgtgtgaccagtgttgctac
tgtacctttggaccgtgtaacctggaaggaaacaagagaggtgcctgtggtattgatatg
aaaggtcaggctgcaagagagttcttcctgcgctgcctaactggttgtgcatgtcacagt
gcccacggccgccacctgcttaatcacattgttgacctcttcgggggagatatgccgatt
aacatgggcgcttcgaatgttattgcccccaatattcagcttgtcacaggtcggcagccg
aagaccctcggcgaactcaaaccaataatggaatatgttgaagaagaggtaggccagtta
cttgcaactgtacacgcaggacaggaagcagcagcaattgactatgataacaaggcaatg
tttgctggagttcttgaccacgtaggtatggaagtttccgatattgctcaggttactgca
ctcggtttcccgaaatccgatcctgaggctcctcttgttgaagtaggtatgggaacaatt
gatgcttccaagccagtcatcattgccattgggcacaacgttgccggtgtcacctacatc
atggactacatggaagacaatggtctgactgacaagatggaaatcggaggtctctgctgt
actgcattcgacatgaccaggtacaagagagaagaccggaaagccccctatgcaaagatt
gtcggtaccatttcaaaggaactgaagatcgtacgctccggaattcctgatgtaatcgtt
cttgacgaacagtgcgtaagagctgacctcgtcatggaaggacagaagcttaagatcccg
atcatcgcatccaatgaaaagatcatgtacggcctggatgacaggaccaatgatgatgtg
gatgcaatcgtagaagacctggtaactggcaagattcctggctgtgtaatgctggactac
gagaaactgggagaacttgtgcccaaggtcgctctgaagatggccccgattcgcgaagcc
gaagggctctcagccatccctacagacgacgaaatgaaagcccttgtttccaagtgtgtg
gaatgcggagaatgtgcactggcatgtccagaagagcttggaatccctgcagcaattgca
gtggctaagggagaagactactctgctctggaagagctgcatgacctttgtgtaggctgt
cgcaggtgcgagcaggtttgtaacaaggaaatccccattctgagcttgatcgagaaggct
gcccagaaggccattgccgaagagaaaggctttgtaagagcaggaagaggtcaggtaagc
gatccagaaatcagggcagaaggcctgaatctggttatgggtaccaccccgggtgtcatc
gcaattatcggatgtgccaactatcctgcaggctccaaagacgtatacagcatcgcagaa
gaattccttaacaggaactacatcgttgcagtttcaggatgttctgcaatggatatcggt
atgtacaaggatgctgacggcaagactctgtacgagagatacccaggtagattcgaaaaa
ggtaacatccttaacaccggatcatgcgtctcgaatgcccacatatcgggtacagtccac
aaggtcgctgcaatctttgcaagcaggaacctttcaggcaaccttgccgagattgctgac
tacgcaatcaaccgtgtcggtgcagtcgggcttgcatggggtgcttactcacagaaggca
gcagctatcggtaccgggtgtaacatgtatggtattcctgcagtacttggtccccacagc
ggtaaatacaggagagctctgatcgcaaagacctacgacgacagcaaatgggaactttac
gacagcagaaacggttccaaaatggcaatcccgccatctccagagttcctgattaccact
gcagaaacctggcaggaagcctgtgtaatgctggcaaagaactgtatccgtgtatctgac
aataacatgggcagatccatcaagttgacccactggctggaaatcagtgaaaagtatctt
ggtgtgctacccgatgactggtggaagtttgtcaggaacgaagctgatctcccactcgcc
aagcgtgaaatgctcctgaagatgcttgaatccgaacgcggttgggaaatcgactggaag
aagaagaagatcatttccggtccggcaattaagttcgatgtctcttcacagccaactaac
cttaagagactttgcaaggaggcctga

DBGET integrated database retrieval system