KEGG   Methanosarcina sp. Kolksee: MSKOL_2893Help
Entry
MSKOL_2893        CDS       T03821                                 

Definition
(GenBank) Alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
mek  Methanosarcina sp. Kolksee
Pathway
mek00500  Starch and sucrose metabolism
mek01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mek00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MSKOL_2893
Enzymes [BR:mek01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MSKOL_2893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1
Motif
Other DBs
NCBI-ProteinID: AKB48670
UniProt: A0A0E3QEJ0
LinkDB All DBs
Position
complement(3750592..3751788)
Genome map
AA seq 398 aa AA seqDB search
MTSVCMYFQVHQPFRLRRFWPDDRSGFFRYFDERSNREIFERVARKCYIPANTLLLDALD
EHKGEFRFSLSVTGTLLEQCELWGKDALEGFRQMAETGSMEFLDETFYHSLSSLFEDKTE
FIEEIKEHRELMFDLLGVKPQVFRNTELLYNNTIAKLVSGLGYRAILTEGADHMLEGRSP
NVLYRAKGSGLPIIFRNYKLSDDIGYRFSARWWEGYPLTAEKWASWASGNNEDCVNIFMD
YETFGEHQWEETGIFSFLKELPGEVLKTHLDFSTPLELVEKYSPVAEIDVGDFSTISWAD
MERDTSAWLGNDMQRRCFEEIKLLEPFVRKTEDPEILRIWKHLLTSDHYYYMCTKWLGDG
DVHSYFSVHSTPFDAAVNFMAVLMDFKAQVFRKLRTIA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgacctcggtttgtatgtatttccaggtacaccagcctttcagactgcgcaggttctgg
cctgatgacagatcagggtttttccgttattttgacgagagaagcaacagggagatcttt
gaaagagtagcccggaaatgctacattcctgcaaatacactcctcctggatgctcttgac
gaacataaaggagaattcaggttttctctttcggttaccgggaccctgctcgaacaatgt
gaactctggggaaaagatgccctcgaaggcttccggcagatggcggaaaccggatcaatg
gaatttctggacgaaaccttttatcattccctttcaagtctttttgaagacaaaaccgag
tttattgaggaaataaaagaacatagagaacttatgtttgaccttctgggagttaaacct
caggtattccggaataccgaactgctttacaataacactatagcaaagcttgtttcgggt
cttgggtacagggcgatccttaccgaaggagcggaccatatgcttgagggaaggtcaccc
aacgtactttacagggcaaaaggttcaggacttcctattatctttagaaattacaagttg
agtgacgatataggatacaggttttctgcaaggtggtgggaagggtatcccctgactgca
gagaaatgggcctcatgggcttcagggaataatgaagattgcgttaatatctttatggac
tatgagaccttcggagagcatcagtgggaagaaaccgggatattttccttcctgaaagaa
cttcccggggaagtgctcaagactcacctggacttcagcacccctcttgagcttgtcgaa
aaatattcccctgtagccgagatcgatgttggggacttttccacaatttcttgggctgat
atggaacgcgatacaagcgcatggcttggaaacgacatgcaaaggcgctgctttgaagaa
ataaagctgcttgaaccctttgtgaggaagacggaggaccctgaaatcctgcgtatatgg
aagcatctgctgacttcggaccattactactatatgtgtaccaaatggctcggagatggg
gatgtacattcatatttcagtgtccattccacgcctttcgatgcagcggttaatttcatg
gctgtacttatggacttcaaagcacaggtattcagaaaacttcgcacaatagcttaa

DBGET integrated database retrieval system