KEGG   Methanosarcina sp. Kolksee: MSKOL_3317
Entry
MSKOL_3317        CDS       T03821                                 

Definition
(GenBank) Proline reductase for pyrrolysine biosynthesis
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
mek  Methanosarcina sp. Kolksee
Pathway
mek00300  Lysine biosynthesis
mek01100  Metabolic pathways
mek01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mek00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    MSKOL_3317
Enzymes [BR:mek01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     MSKOL_3317
SSDB
Motif
Pfam: NAD_binding_2 NAD_binding_7 2-Hacid_dh_C UDPG_MGDP_dh_N 3HCDH_N
Other DBs
NCBI-ProteinID: AKB49094
UniProt: A0A0E3QGS6
LinkDB
Position
complement(4285629..4286408)
AA seq 259 aa
MALLTPNDLININRKLQEADSVVQKVTGLDIKGVCQALYGTSPLSEKVGIVPVTSGNGII
GNFSASLHAITQYFGFDSFVTDMPDVSGYYEAVQNGAEIILMADDHTFLAHNIKNGKMAN
NQPCTGVIYAEIASRYLKADSKDVLVMGLGKVGFPGAAQLVQKGFRVYGYDPDARLLKRA
VSDLGVIPLDPANPKKFSIIFEATPCANTIPETVLSENCVLSTPGIPCAISEELRKKYDV
QLVAEPLGIGTASMLYSVL
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcacttttaaccccaaatgatttgataaatattaatagaaaacttcaggaagccgac
tctgtcgtgcaaaaagtaacagggcttgatataaaaggcgtctgtcaagctctctacggt
acttccccgctctccgaaaaagtaggtatcgtgcctgtaacttcaggaaatgggataata
ggaaacttttctgcttccctgcatgcaattacgcagtatttcggatttgacagttttgtt
acggatatgccggatgttagcggctattatgaagctgtgcagaacggagccgagatcatc
cttatggcagacgaccacactttccttgcccataacatcaaaaatggaaaaatggccaat
aatcaaccctgcacaggtgtaatttatgctgagatcgcttccagatacctgaaagccgac
tcaaaggacgtacttgttatggggcttggaaaggtaggttttcccggagcagcccaactt
gtgcagaaaggcttcagggtttacgggtatgatcctgatgcaagactccttaagagagct
gtttcagacctcggggttatcccactcgatcctgcaaatccgaaaaagttttccattatt
ttcgaggcgaccccatgtgcaaacacgattcctgaaaccgtactttcggagaattgcgtg
ctttcaactccaggaattccctgcgcaatttctgaagagcttcgaaagaaatacgacgtt
caacttgtagctgagccccttggaataggaacggcatcaatgctgtattctgtgctttaa

DBGET integrated database retrieval system