KEGG   Methanosarcina sp. Kolksee: MSKOL_3383Help
Entry
MSKOL_3383        CDS       T03821                                 

Definition
(GenBank) Ribulose-1,5-bisphosphate carboxylase, Type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mek  Methanosarcina sp. Kolksee
Pathway
mek00630  Glyoxylate and dicarboxylate metabolism
mek01100  Metabolic pathways
mek01120  Microbial metabolism in diverse environments
mek01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mek00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MSKOL_3383
Enzymes [BR:mek01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MSKOL_3383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AKB49160
UniProt: A0A0E3QIE2
LinkDB All DBs
Position
complement(4365080..4366366)
Genome map
AA seq 428 aa AA seqDB search
MRRDYIDMDYSPKDTDLVCEFHIEPSAGVNFEEAATHMAGESSIDSWTEIATLSPELAAR
LKPHVFYVDEDAQTVRVAYSEELFELGSVPQVLSAVAGNIFSMKIVDNLRLQDIAFPKSM
LSEFKGPGFGLPGIKELTGVQDRPLIGTIVKPKVGLTSEKHAEVAYNSFAGGCDLVKDDE
NLTDQKFNRFEKRAELTLKLAEKAESETGERKMYLCNITAPTCKEMIRRMNILKDLGASY
AMIDIVPVGWTALQTLREEADDAGLALHAHRCMHSAYTRNPHHGISMLVVAKLCRLVGLD
QLHIGTVVGKMHGEKHEVLSLRDECVLDNVPADESQHVLAQDWGGLKPMFPVASGGLAPT
MIPDLYTIFGRDVIMQFGGGIHAHPMGTAAGATACRQALEAALEGVSLQEYAKNHRELEL
AIDKWLKK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagagattatatagacatggactatagcccgaaggatactgatctggtatgtgag
ttccatatcgaaccgtcagcaggagtgaattttgaggaagctgcaacccatatggcaggg
gaaagctctatagattcctggactgaaatcgccacactcagtcccgaacttgcagccagg
ctaaaaccccatgttttttacgtagatgaggatgcacagactgtaagggtagcttactcg
gaagaactctttgaacttggttctgtcccgcaggtactcagtgcggttgcaggaaatatc
tttagtatgaaaatcgttgacaatctcagactgcaggatatagctttcccgaagtcaatg
ctctccgaattcaaaggtcctggattcgggttgccaggaatcaaggaacttacaggtgtg
caggacaggcctctcataggaactattgtcaagccgaaagttggattaacctctgaaaaa
catgctgaggtcgcttacaattcatttgcaggaggctgcgaccttgttaaagatgacgag
aaccttacggatcagaaatttaacagatttgaaaaaagagctgaacttactctgaagctt
gcagaaaaagcagaatctgagaccggagagcgtaaaatgtatctctgcaacattactgct
cctacctgtaaggaaatgatccgtcgcatgaacattcttaaagacctgggtgccagctat
gcgatgatcgacatcgtacctgtgggctggactgcacttcagaccttaagggaagaagca
gacgatgcagggcttgctctccatgcccaccgatgcatgcattcagcctataccaggaac
ccacaccatgggataagcatgcttgtcgttgccaagctctgcagactggtcgggcttgat
cagcttcacatcggtactgtagtagggaaaatgcacggagaaaaacacgaggttctatct
ctccgtgatgagtgtgtgttagacaatgtgcctgcggatgaaagccagcatgtacttgcc
caggactggggagggttgaagcctatgttcccggttgcttccggagggcttgcccctact
atgattcctgacctgtacactatcttcggaagggatgttattatgcaattcggtggcgga
attcacgcccatccaatgggtacggcagccggagccactgcttgcaggcaggcactcgaa
gcagcccttgagggagttagcctgcaggaatatgcgaaaaaccacagagaacttgaactt
gccatcgataagtggctgaagaaataa

DBGET integrated database retrieval system