KEGG   Methanobacterium lacus: Metbo_2463Help
Entry
Metbo_2463        CDS       T01437                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mel  Methanobacterium lacus
Pathway
mel03030  DNA replication
mel03410  Base excision repair
mel03420  Nucleotide excision repair
mel03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mel00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Metbo_2463
   03410 Base excision repair
    Metbo_2463
   03420 Nucleotide excision repair
    Metbo_2463
   03430 Mismatch repair
    Metbo_2463
Enzymes [BR:mel01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Metbo_2463
    6.5.1.6  DNA ligase (ATP or NAD+)
     Metbo_2463
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Metbo_2463
DNA replication proteins [BR:mel03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Metbo_2463
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Metbo_2463
DNA repair and recombination proteins [BR:mel03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Metbo_2463
   NER (nucleotide excision repair)
    Other NER factors
     Metbo_2463
   MMR (mismatch exicision repair)
    Other MMR factors
     Metbo_2463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ADZ10676
UniProt: F0T742
LinkDB All DBs
Position
complement(2501315..2502997)
Genome map
AA seq 560 aa AA seqDB search
MKDSHDGTSYSKMVEVYEELDSTTKRLEKTSILAKFFNEIGNEDSELLPVVTLLSLGRVF
PTWSEEELGIGSKLLMKAIALVVGVKPEEVEDKQRDAGDIGRAAQELFSKKKQATLFSRK
LTIKKVRSNLMKMATVSGNRAQSKKLEILRELLSSASPTEAKYITRTVIEELRVGVGEGT
IRDALSQAFGVDKAIVERAHMLTNDLGLVAEVSKEEGVEGLQKLSLNPGKPVKPMLAQLS
PGIETSITEMGWAFCETKYDGIRVQIHRLGDEVNVFTRRLENISNAVPEIVEYIKKDLPH
KNFIVEGEIIVTRDGKPISFQYILQRVRRKYDIERMRNEVPLKLYLFDVLYYGEPLLDAP
FEKRREVLESIVNITPDKIELSEQVKVTSESVQEAQDLFNNSIKGGHEGIMIKDPTAPYI
PGIRGKKMLKFKAEPETLDLVVVGGTYGKGKRAHFIGSYLLAAQDEDNEFKTLAHAATGL
DDKTLQELSELSEPLITSKVGRQVQIAPQIILEIAYSEIVKSPEYESGYSLRFPVVKRIR
NDLSLDDIDTVDRINSMFKE
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattcacatgatggtacaagttacagtaaaatggttgaagtttacgaagaactg
gattcaactaccaaaagacttgaaaaaacatctatactagcaaaattttttaatgagata
ggtaatgaggattcagaacttttaccggtggtcacgctactctcccttggaagggttttc
cctacgtggagtgaggaagaactgggcataggttctaaactgctaatgaaagcaatagca
ttggttgtaggtgtaaaacctgaggaagtggaagataagcagagggatgctggagatatt
ggtagagctgcccaggaattattttcaaagaaaaaacaggcgaccctgttctcaagaaag
ctaaccattaaaaaggtgcgaagcaacctaatgaagatggccacagtgtctggaaacagg
gctcaatctaaaaaactcgaaatattgcgggaattattatcatctgcctctccaactgag
gctaaatacataaccagaacagttattgaagaattgagggtgggggtgggtgaaggaacc
atcagggacgcactttcccaggccttcggtgttgataaggctattgttgaaagggcacat
atgctcaccaatgatcttggcctggttgcagaggtttccaaagaagaaggggttgaagga
cttcaaaaactctcattaaatcctggaaaacctgttaagcccatgcttgcacagctttct
cctggaattgaaacaagtattacagagatgggatgggctttttgtgaaaccaaatacgat
ggtatccgggtgcagatacacagactcggagatgaagttaatgttttcaccagaagactc
gaaaatatcagtaatgcagttccagaaattgttgagtacataaaaaaagatttaccacat
aaaaatttcattgtggaaggtgaaataattgttacgcgtgatggaaaaccaatttccttc
cagtatatcctccagagggttaggaggaagtacgatattgaaaggatgagaaatgaagta
cctcttaaattatacctctttgatgttctttactacggagaaccgttacttgatgctcca
tttgaaaagagaagagaagttctcgaatcaattgtgaatataactcctgataaaattgaa
ttaagtgaacaggtcaaggtcacttctgaatctgttcaagaggctcaggatctctttaac
aattccattaaaggaggtcatgagggtataatgattaaagatcccacagccccatacatc
cctggtatccggggtaaaaaaatgcttaaatttaaagcagaacctgaaaccctcgatctg
gttgtggttggggggacctatggtaaaggaaaaagggcacatttcataggatcctacctc
ctggctgcccaggatgaggacaacgaatttaaaactcttgcccatgctgccacaggcctt
gatgataaaacccttcaggaactttctgaactaagtgaaccactcataaccagtaaggtt
gggaggcaggtccaaattgctcctcaaattattctcgagatagcttacagtgaaattgtt
aaaagtccggaatacgagtccggatattctttaagattccctgtggttaagagaataagg
aatgaccttagtttggatgatattgacactgtggatagaataaattccatgttcaaggaa
tga

DBGET integrated database retrieval system