KEGG   Melaminivora sp. SC2-9: C6568_00195Help
Entry
C6568_00195       CDS       T05358                                 

Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mela  Melaminivora sp. SC2-9
Pathway
mela00020  Citrate cycle (TCA cycle)
mela00310  Lysine degradation
mela00380  Tryptophan metabolism
mela01100  Metabolic pathways
mela01110  Biosynthesis of secondary metabolites
mela01120  Microbial metabolism in diverse environments
mela01130  Biosynthesis of antibiotics
mela01200  Carbon metabolism
Module
mela_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mela_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mela00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C6568_00195
  09105 Amino acid metabolism
   00310 Lysine degradation
    C6568_00195
   00380 Tryptophan metabolism
    C6568_00195
Enzymes [BR:mela01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     C6568_00195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AVO47850
UniProt: A0A2R3Q7V3
LinkDB All DBs
Position
38658..39920
Genome map
AA seq 420 aa AA seqDB search
MSIVEVKVPQLSESVAEATLMSWKKKAGEAVAADEILIEIETDKVVLEVPAPAAGVLAEI
VEADGATVASEQVIARIDTNAVASAAPASAPAAAPAAAASAPAAVAAPAAGGSKGDVAMP
AAAKILSEKGLSPSDVQGSGKDGRVTKGDALAASAGGVKSTAAVIPTGVPTKALPQVAAP
TSAQELGERPEQRVPMSRLRARIAERLLQSQSTNAILTTFNEVNMAPVMELRKKFQDQFT
KEHGVKLGFMSFFVKAAVHALKKFPVINASVDGNDIVYHGYFDIGIAVGSPRGLVVPILR
NADQMSFADIEKKIAEFGKKAAEGKLGIEEMTGGTFSISNGGTFGSMMSTPIINPPQSAI
LGVHATKDRAMVENGQVVVRPMNYLALSYDHRIIDGREAVLGLVAMKDALEDPSRLLFDL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcgttgaagtcaaggttccccagctgtccgagtccgtggccgaggccacgctg
atgtcctggaagaagaaggccggcgaagccgtcgccgccgacgaaatcctcatcgagatc
gagaccgacaaggtggtgctggaagtgcctgcgcccgccgccggcgtgctcgccgagatc
gtggaggccgacggcgccaccgtcgcctcggagcaggtcatcgcacgcatcgacaccaat
gccgtggcctctgctgcgccggcgtcggcaccggctgccgcacccgctgctgccgcctcg
gcgcccgctgcagttgccgctcctgccgctggtggcagcaagggcgacgtggccatgccg
gccgccgccaagatcctgtcggagaaaggtctgtcgccctccgacgtgcagggctcgggc
aaggacggccgcgtgaccaagggcgacgcgcttgctgcatcggccggcggtgtgaagtcc
accgccgcggtcatcccgaccggcgtgccgaccaaggcgctgccgcaggtggccgcgccg
acgtccgcgcaggagctgggcgagcgccccgagcagcgcgtgcccatgagccgcctgcgc
gcgcgcatcgccgagcgcctgctgcagtcgcagtccaccaacgccatcctgaccaccttc
aacgaggtcaacatggcgccggtgatggagctgcgcaagaagttccaggaccagttcacc
aaggagcacggcgtcaagctcggattcatgagcttcttcgtgaaggcggcggtgcatgcg
ctgaagaagttcccggtcatcaacgccagcgtggacggcaacgacatcgtctaccacggc
tacttcgacatcggcatcgccgtgggctcgccgcgcggcctggtggtgcccatcttgcgc
aacgccgaccagatgagctttgccgacatcgaaaagaagatcgccgagttcggcaagaag
gccgccgagggcaagctgggcatcgaggagatgaccggcggcacgttctcgatttccaac
ggcggcacattcggctcgatgatgtccacccccatcatcaacccgccgcagtccgccatc
ctgggcgtgcacgccaccaaggaccgcgccatggtcgagaacggccaggtcgtggtgcgc
ccgatgaactatctggcgctgtcgtacgaccaccgcatcatcgacggccgtgaggccgtg
ctgggcctggtggccatgaaggatgcgctggaagacccctcgcgtctgctcttcgacctg
taa

DBGET integrated database retrieval system