KEGG   Melaminivora sp. SC2-9: C6568_07075Help
Entry
C6568_07075       CDS       T05358                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mela  Melaminivora sp. SC2-9
Pathway
mela00564  Glycerophospholipid metabolism
mela01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mela00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    C6568_07075
Enzymes [BR:mela01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     C6568_07075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored NAD_binding_8 Pyr_redox_2 HI0933_like 3HCDH_N Lycopene_cycl Thi4 FAD_binding_3 GIDA Pyr_redox_3 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AVO49041
UniProt: A0A2R3QBB2
LinkDB All DBs
Position
complement(1491976..1493574)
Genome map
AA seq 532 aa AA seqDB search
MTSDTTDPLPTDRTALLAQLAQPHTYDLAVVGGGATGLGVALDAAARGFSVVLLESHDFA
KGTSSRATKLVHGGVRYLAQGNIALVREALHERTTLLANAPHLAQPLAFVMPSYKLWETP
FYGTGLKMYDALAGKAGLGDTQLLGRMETLRCLPTAVAEGLKGGVKYWDGQFDDARLALA
LARTAAAKGALLVNYCPVTDLLYDAGKIAGVVCEDVETRRSFQVRARCVVNAAGVWVDAL
RQRDGAQAGRQLAPMVAPSQGVHLVVDRDFLPSDHALMVPKTADGRVLFAVPWLGKLILG
TTDTPRHDLAREPVAMRDEVAFILGEAARYLRRAPRAQDVRSIWVGLRPLVKPQGEDGGN
TKRISREHTVIASASGLVTVTGGKWTTYRAMAEDVLDKCFEARLLPRRAGGVTVALPLVG
APPSRPRQGMHLPQGLHSYGTEAAAVAALPGTDVVLADGFTEAMVRWAVRHEYARTVEDV
LARRTRVLFLDARLAQALAPRVAQILGEELPGHDPQLAPFLELALQYATVPG
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacttccgacaccaccgaccctttgccgaccgaccgcaccgcgctgctcgcgcagctc
gcccagccgcacacctatgacctggcggtggtcggcggcggcgccaccggcctgggcgtg
gcgctggatgcggcggcgcgcggcttttccgtggtgctgctggagtcgcacgacttcgcc
aagggcacttcgtcgcgcgccaccaagttggtgcatggcggcgtgcgctatctggcccag
ggcaacatcgctctggtgcgcgaagccctgcacgagcgcaccacgctgcttgccaacgcc
ccgcacctggcgcagccgctggccttcgtcatgccgtcctacaagctgtgggagacgccg
ttctacggcacgggcctgaagatgtacgacgcgctggccggcaaggcgggcctgggcgat
acgcagctgctgggccggatggagacgctgcgctgcctgcccaccgcagtggccgaaggc
ctcaagggcggcgtcaagtattgggatgggcaattcgacgatgcccgcctggccctggcg
ctggcgcgcacggcggccgccaagggggcgcttttggtcaactactgcccggtgaccgat
ttgctgtatgacgccggcaagatcgccggggtggtctgcgaagacgtcgagacgcggcgc
agtttccaagtgcgggcacgctgcgtggtcaatgccgcgggtgtgtgggtcgatgccctg
cgccagcgcgacggcgcgcaggccggccgccaactggcgcccatggtcgcgcccagccag
ggcgtgcacttggtggtggaccgtgacttcctgcccagcgaccatgcgctgatggtgccc
aagacggccgacggccgcgtcctgtttgccgtgccgtggctgggcaagctgatcctgggc
acgaccgacacgccgcgccacgatctggcgcgcgagccggtggccatgcgggacgaggtt
gccttcatcctgggcgaggcagcgcgctacctgcgccgtgcgccccgggcgcaggatgtg
cgcagcatctgggtcggcctgcgccccctggtcaagccgcagggcgaggacggtggcaac
accaagcgcatcagccgtgagcacacggtgattgccagcgccagcggcctggtcaccgtg
accggtggcaagtggaccacctaccgcgccatggccgaggatgtgctggacaagtgcttc
gaggcccgattgctgccgcgccgtgcgggcggcgtgacggtggctctgccactggtgggc
gcgccgccctccaggccacgccagggcatgcatctgccgcagggcctgcactcctacggg
accgaggccgctgcggtggcggccttgccgggaaccgacgtggttctggccgatggcttc
accgaagccatggtgcgctgggccgtgcggcatgaatatgcgcgcaccgtcgaggacgtg
ctggcgcgccgcacccgggtgctgttcctcgacgcacgcctggcgcaggcactggcgccg
cgcgtggcgcagatcctcggcgaggagctgcccggccatgatccgcaactggcccccttc
ctggagcttgccctgcagtacgccaccgtgcccggttga

DBGET integrated database retrieval system