KEGG   Melaminivora sp. SC2-9: C6568_07750Help
Entry
C6568_07750       CDS       T05358                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
mela  Melaminivora sp. SC2-9
Brite
KEGG Orthology (KO) [BR:mela00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    C6568_07750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AVO49164
UniProt: A0A2R3QBW2
LinkDB All DBs
Position
1619548..1620306
Genome map
AA seq 252 aa AA seqDB search
MEWIIVSLASLLAGFVDAIVGGGGLILLPALFATFPAAAPATLMGTNKSAAIWGTGIATW
QYSRRVSMRWQAMLPATAAGFIGAFLGAWLVTLIAADFLRKLLPLVLVALLVYTLVKKDL
GRTHAPRLAARAEVWAASAIGLSIGFYDGFFGPGTGSFFVFLFVRVLGYDFLHASASAKL
LNLATNVSALILFAAKGHVWWHFALPLALANVIGSLLGAHLALKHGAGFVRGIFIVVVGA
LIVKTGWDAFLR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggaatggatcatcgtctcgctggcctcgctgctggccggcttcgtggacgcgatcgtc
ggcggcggcgggctgatcctgctgccagccctgtttgccaccttccccgctgcagcgccg
gccacgctcatgggcaccaacaagagcgcggccatctggggcacgggcatcgccacctgg
cagtacagccggcgcgtgagcatgcgctggcaggccatgctgccggccaccgcggcgggc
ttcataggcgccttcctgggcgcctggctggtcacgctgatcgcggcggattttttgcgc
aagctgctgccgctggtgttggtcgcgctgctggtctacacgctggtgaagaaagacctg
ggccgcacgcatgcgccgcgcctggccgcgcgcgctgaagtgtgggcggccagcgccatc
ggcctgtccatcggtttttacgacggcttcttcggccccggcacgggcagcttcttcgtt
ttcctgttcgtgcgcgtgctgggctacgattttctgcacgcctcggcctcggccaagctg
ctgaacctggcgaccaacgtctcggcgctgatcctgttcgccgccaagggccatgtgtgg
tggcatttcgcgctgccgctggcgctggccaacgtgatcggcagcctcctgggcgcccac
ctggcgctcaagcacggcgcgggcttcgtgcgcggcatcttcatcgtcgtggtcggcgcg
ctgatcgtgaagaccgggtgggatgctttcctgcgttga

DBGET integrated database retrieval system