KEGG   Melaminivora sp. SC2-9: C6568_13985Help
Entry
C6568_13985       CDS       T05358                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mela  Melaminivora sp. SC2-9
Brite
KEGG Orthology (KO) [BR:mela00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C6568_13985
Enzymes [BR:mela01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C6568_13985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored Thioredoxin_3 HI0933_like Glutaredoxin AlaDh_PNT_C FAD_binding_3 FAD_binding_2 NAD_binding_7 DAO NAD_binding_8 NAD_binding_9 Thi4 K_oxygenase FMO-like DSBA
Motif
Other DBs
NCBI-ProteinID: AVO50233
UniProt: A0A2R3QEM8
LinkDB All DBs
Position
2977249..2978817
Genome map
AA seq 522 aa AA seqDB search
MLDANLQNQLKAYLERLQRPVELVATLDDSATARELRELLNQIASLSDQVTVVEANDVPV
RKPSFLITNPGVDTGVRFAGVPLGHEFTSLVLALLQVGGHPSKEAADLLEQVKGLEGEFH
FETYYSLSCHNCPEVVQALNLMSVLNPGITHTAIDGAVFQQEIKDREVMGVPTVFLNGEH
FGQGRMELAEIVGKIDSGAAARDAEKINAKEPFDVLIVGGGPAGAAAAIYAARKGIRTGI
AAERFGGQVLDTLDIENYISIQRTEGPLFAAAMERHVRDYEVDVMNLQMARALRPAPSEG
GLIEIELENGATLRGRSVILATGARWRNMGVPGEDEYRTRGVAYCPSCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVAHVTLLEFAPELKADAVLQRKLRSMPNVDIILNAQTTEVTGD
GTRVNGLIYKDRASEQVHQIALEGIFVQIGLLPNTEWLKGTVDLTPFGEIKVDARNHTNV
PGVFAAGDCTTVPYKQIVIAAGEGSKAALSAFDHLIRTSAPA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctgcaaaaccaactgaaagcctacctggagcgcctgcagcgcccc
gtggaactggtggccacgctggatgacagcgccaccgcgcgcgagctgcgcgaactcctg
aaccagatcgcgtccctgtcggaccaggtcaccgtggtcgaggcgaacgacgtgcccgtg
cgcaagccgtcttttttgatcaccaaccccggcgtggacaccggcgtgcgctttgccggc
gttcccctgggccatgaattcacctcgctggtgctggcgctgctgcaggttggcggccat
ccgtccaaggaagcggccgatctgctggagcaggtcaagggcctggagggtgagttccac
ttcgagacgtattactcgctgtcgtgccacaactgcccggaggtggtgcaggcgctgaac
ctgatgagcgtgctcaaccccggcatcacacacaccgccatcgacggcgccgtgttccag
caggaaatcaaggaccgcgaggtcatgggcgtgcccaccgtgtttttgaacggcgagcac
ttcggccagggccgcatggagctggctgagatcgtcggcaagatcgactcgggagcggca
gcgcgcgatgcggaaaagatcaacgccaaggagcccttcgacgtgctgatcgtcggcggc
ggcccggccggcgcggcggcggccatctacgccgcgcgcaagggcatccgcaccggcatc
gccgccgaacgcttcggcggccaggtgctggatacgctggacatcgagaactacatctcc
atccagcggaccgaaggtccattgttcgccgccgcaatggagcgccacgtgcgcgactac
gaggtggacgtcatgaacctgcaaatggcgcgcgccctgcggcccgcacccagcgagggc
ggcctgatcgagatcgagctggagaatggcgccacgctgcgcgggcgcagcgtcatcctg
gccactggcgcgcgttggcgcaacatgggcgtgccgggcgaggacgagtaccgcacgcgt
ggcgtcgcctattgcccgagctgcgacggccccctgttcaagggtaagcgcgtggcggtg
atcggtggcggcaattcgggtgtggaggcggccatcgatctggcgggcatcgtggcgcat
gtcacgctgctggagttcgcgcccgagctgaaggccgacgccgtgctgcagcgcaagctg
cgcagcatgcccaacgtggacatcatcctgaacgcgcagaccaccgaggtgaccggcgac
ggcacgcgcgtcaacggcctgatctacaaggatcgcgccagcgagcaggtgcaccagatc
gcgctggaaggcatcttcgtgcagattggcctgctgcccaacaccgaatggctcaagggc
acagtggatctcacgcccttcggtgagatcaaggtcgatgcgcgcaaccacaccaacgtg
ccgggcgtgttcgccgcgggcgactgcaccacggtgccctacaagcagatcgtgatcgcg
gcgggcgagggctccaaggcggcgctgtcggctttcgaccacctgatccgcaccagcgcg
ccggcctga

DBGET integrated database retrieval system